Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003615000
  • symbol?:
  • description?: lysophospholipase

      descriptions from strain specific annotations:

    • lysophospholipase
    • alpha/beta hydrolase
    • alpha/beta fold family hydrolase
    • Monoglyceride lipase
    • putative
    • alpha/beta hydrolase fold family protein
    • hydrolase alpha/beta fold domain-containing protein
    • lysophophospholipase
    • putative hydrolase
    • Lysophospholipase, Monoglyceridelipase, putative
    • Lysophospholipase L2
    • Hydrolase
  • strand?: +
  • coordinates?: 3955951..3956868
  • synteny block?: BlockID0026860
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1259
    08BA02176:
    C248_1336
    11819-97:
    MS7_1259
    71193:
    ST398NM01_1304
    ECT-R 2:
    ECTR2_1159
    ED133:
    SAOV_1303
    ED98:
    SAAV_1276
    HO 5096 0412:
    SAEMRSA15_11360
    JH1:
    SaurJH1_1387
    JH9:
    SaurJH9_1361
    JKD6008:
    SAA6008_01256
    JKD6159:
    SAA6159_01156
    LGA251:
    SARLGA251_12120
    M013:
    M013TW_1243
    MRSA252:
    SAR1277
    MSHR1132:
    SAMSHR1132_11440
    MSSA476:
    SAS1235
    Mu3:
    SAHV_1292
    Mu50:
    SAV1303
    MW2:
    MW1185
    RF122:
    SAB1163
    ST398:
    SAPIG1304
    T0131:
    SAT0131_01358
    TCH60:
    TW20:
    SATW20_12950
    USA300_TCH1516:
    USA300HOU_1233
    VC40:
    SAVC_05705

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTEKQFKLTVQDNTNIEVKVNFTDVDSKGIIHIFHGMAEHMERYDKLAHALSKHGFDVIR
    N315            MTEKQFKLTVQDNTNIEVKVNFTDVDSKGIIHIFHGMAEHMERYDKLAHALSKHGFDVIR
    NCTC8325        MTEKQFKLTVQDNTNIEVKVNFTDVDSKGIIHIFHGMAEHMERYDKLAHALSKHGFDVIR
    Newman          MTEKQFKLTVQDNTNIEVKVNFTDVDSKGIIHIFHGMAEHMERYDKLAHALSKHGFDVIR
    USA300_FPR3757  MTEKQFKLTVQDNTNIEVKVNFTDVDSKGIIHIFHGMAEHMERYDKLAHALSKHGFDVIR
                    ************************************************************

    COL             HNHRGHGINIDESTRGHYDDMKRVIGDAFEVAQTVRGNVDKPYIIIGHSMGSVIARLFVE
    N315            HNHRGHGINIDESTRGHYDDMKRVIGDAFEVAQTVRGNVDKPYIIIGHSMGSVIARLFVE
    NCTC8325        HNHRGHGINIDESTRGHYDDMKRVIGDAFEVAQTVRGNVDKPYIIIGHSMGSVIARLFVE
    Newman          HNHRGHGINIDESTRGHYDDMKRVIGDAFEVAQTVRGNVDKPYIIIGHSMGSVIARLFVE
    USA300_FPR3757  HNHRGHGINIDESTRGHYDDMKRVIGDAFEVAQTVRGNVDKPYIIIGHSMGSVIARLFVE
                    ************************************************************

    COL             TYPQYVDGLILSGTGMYSLWKGLPTVKVLQLITKIYGAEKRVEWVNQLVSNSFNKKIRPL
    N315            TYPQYVDGLILSGTGMYSLWKGLPTVKVLQLITKIYGAEKRVEWVNQLVSNSFNKKIRPL
    NCTC8325        TYPQYVDGLILSGTGMYSLWKGLPTVKVLQLITKIYGAEKRVEWVNQLVSNSFNKKIRPL
    Newman          TYPQYVDGLILSGTGMYSLWKGLPTVKVLQLITKIYGAEKRVEWVNQLVSNSFNKKIRPL
    USA300_FPR3757  TYPQYVDGLILSGTGMYSLWKGLPTVKVLQLITKIYGAEKRVEWVNQLVSNSFNKKIRPL
                    ************************************************************

    COL             RTQSDWISSNPIEVDNFIKDPYSGFNVSNQLLYQTAYYMLHTSQLKNMKMLNHAMPILLV
    N315            RTQSDWISSNPIEVDNFIKDPYSGFNVSNQLLYQTAYYMLHTSQLKNMKMLNHAMPILLV
    NCTC8325        RTQSDWISSNPIEVDNFIKDPYSGFNVSNQLLYQTAYYMLHTSQLKNMKMLNHAMPILLV
    Newman          RTQSDWISSNPIEVDNFIKDPYSGFNVSNQLLYQTAYYMLHTSQLKNMKMLNHAMPILLV
    USA300_FPR3757  RTQSDWISSNPIEVDNFIKDPYSGFNVSNQLLYQTAYYMLHTSQLKNMKMLNHAMPILLV
                    ************************************************************

    COL             SGYDDPLGDYGKGILKLANIYRKAGIKNVKVNLYHHKRHEVLFEKDHDKIWEDLFKWLNQ
    N315            SGYDDSLGDYGKGILKLANIYRKAGIKNVKVNLYHHKRHEVLFEKDHDKIWEDLFKWLNQ
    NCTC8325        SGYDDPLGDYGKGILKLANIYRKAGIKNVKVNLYHHKRHEVLFEKDHDKIWEDLFKWLNQ
    Newman          SGYDDPLGDYGKGILKLANIYRKAGIKNVKVNLYHHKRHEVLFEKDHDKIWEDLFKWLNQ
    USA300_FPR3757  SGYDDPLGDYGKGILKLANIYRKAGIKNVKVNLYHHKRHEVLFEKDHDKIWEDLFKWLNQ
                    *****.******************************************************

    COL             FYKK
    N315            FYKK
    NCTC8325        FYKK
    Newman          FYKK
    USA300_FPR3757  FYKK
                    ****