From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003622000
  • symbol?: bsaA
  • description?: glutathione peroxidase

      descriptions from strain specific annotations:

    • glutathione peroxidase
    • Glutathione peroxidase family protein
    • Glutathione peroxidase -like protein BsaA
    • peroxiredoxin HYR1
    • peroxiredoxin Hyr1 (hydrogen peroxide resistanceprotein 1) (oxidant receptor peroxidase 1) (glutathione peroxidase 3)(phospholipid hydroperoxide glutathione peroxidase 3) (phgpx3)
    • putative glutathione peroxidase
  • strand?: -
  • coordinates?: 3959813..3960289
  • synteny block?: BlockID0026920
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1325 (gpxA1)
    N315:
    SA1146 (bsaA)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1262 (bsaA)
    08BA02176:
    C248_1339
    11819-97:
    MS7_1262
    71193:
    ST398NM01_1307
    ECT-R 2:
    ECTR2_1162
    ED133:
    SAOV_1306c
    ED98:
    SAAV_1279 (gpxA1)
    HO 5096 0412:
    SAEMRSA15_11390
    JH1:
    SaurJH1_1390
    JH9:
    SaurJH9_1364
    JKD6008:
    SAA6008_01259 (bsaA)
    JKD6159:
    SAA6159_01159 (bsaA)
    LGA251:
    SARLGA251_12150
    M013:
    M013TW_1246
    MRSA252:
    SAR1280
    MSHR1132:
    SAMSHR1132_11470
    MSSA476:
    SAS1238
    Mu3:
    SAHV_1295 (bsaA)
    Mu50:
    SAV1306 (bsaA)
    MW2:
    MW1188 (bsaA)
    RF122:
    SAB1168c
    ST398:
    SAPIG1307
    T0131:
    SAT0131_01361
    TCH60:
    HMPREF0772_11921 (gpo2)
    TW20:
    SATW20_12980
    USA300_TCH1516:
    USA300HOU_1236 (bsaA)
    VC40:
    SAVC_05720

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             METIYDFVVETNKGVTYKLDAYKGDVMLIVNTASECGFTSQFEGLQSLYEKYKDQGFVIL
    N315            METIYDFVVETNKGVTYKLDAYKGDVMLIVNTASECGFTSQFEGLQSLYEKYKDQGFVIL
    NCTC8325        METIYDFVVETNKGVTYKLDAYKGDVMLIVNTASECGFTSQFEGLQSLYEKYKDQGFVIL
    Newman          METIYDFVVETNKGVTYKLDAYKGDVMLIVNTASECGFTSQFEGLQSLYEKYKDQGFVIL
    USA300_FPR3757  METIYDFVVETNKGVTYKLDAYKGDVMLIVNTASECGFTSQFEGLQSLYEKYKDQGFVIL
                    ************************************************************

    COL             GFPCNQFGGQEPGSGEEAAQNCKLNYGVTFPMHQKIDVKGEHQLPLFRYLTAAQHGFFNE
    N315            GFPCNQFGGQEPGSGEEAAQNCKLNYGVTFPMHQKIDVKGEHQLPLFRYLTAAQHGFFNE
    NCTC8325        GFPCNQFGGQEPGSGEEAAQNCKLNYGVTFPMHQKIDVKGEHQLPLFRYLTAAQHGFFNE
    Newman          GFPCNQFGGQEPGSGEEAAQNCKLNYGVTFPMHQKIDVKGEHQLPLFRYLTAAQHGFFNE
    USA300_FPR3757  GFPCNQFGGQEPGSGEEAAQNCKLNYGVTFPMHQKIDVKGEHQLPLFRYLTAAQHGFFNE
                    ************************************************************

    COL             KIKWNFTKFLVDREGNVVKRFAPQKKPVQIEREIEKLL
    N315            KIKWNFTKFLVDREGNVVKRFAPQKKPVQIEREIEKLL
    NCTC8325        KIKWNFTKFLVDREGNVVKRFAPQKKPVQIEREIEKLL
    Newman          KIKWNFTKFLVDREGNVVKRFAPQKKPVQIEREIEKLL
    USA300_FPR3757  KIKWNFTKFLVDREGNVVKRFAPQKKPVQIEREIEKLL
                    **************************************