From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003680000
  • symbol?:
  • description?: low specificity L-threonine aldolase

      descriptions from strain specific annotations:

    • low specificity L-threonine aldolase
    • aromatic amino acid beta-eliminating lyase/threonine aldolase
    • aromatic amino acid beta-eliminating lyase
    • beta-eliminating lyase family protein
  • strand?: -
  • coordinates?: 3989989..3991015
  • synteny block?: BlockID0027460
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1271
    08BA02176:
    C248_1354
    11819-97:
    MS7_1279
    71193:
    ST398NM01_1322
    ECT-R 2:
    ECTR2_1175
    ED133:
    SAOV_1329c
    ED98:
    SAAV_1295
    HO 5096 0412:
    SAEMRSA15_11630
    JH1:
    SaurJH1_1404
    JH9:
    SaurJH9_1377
    JKD6008:
    SAA6008_01280 (gLY1)
    JKD6159:
    SAA6159_01183 (gLY1)
    LGA251:
    SARLGA251_12290
    M013:
    M013TW_1268
    MRSA252:
    SAR1326
    MSHR1132:
    SAMSHR1132_11610
    MSSA476:
    SAS1256
    Mu3:
    SAHV_1304
    Mu50:
    SAV1315
    MW2:
    MW1203
    RF122:
    SAB1178c
    ST398:
    SAPIG1322
    T0131:
    SAT0131_01383 (rpsF)
    TCH60:
    HMPREF0772_11893 (ltaE)
    TW20:
    SATW20_13180
    USA300_TCH1516:
    USA300HOU_1260
    VC40:
    SAVC_05820

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ----------MISFENDYLEGAHEKVLKRLVDTNLVQASGYGFDQFTAQAIEKIKDTIDC
    N315            ----------MISFENDYLEGAHEKVLKRLVDTNLVQASGYGFDQFTAQAIEKIKDTIDC
    NCTC8325        ----------MISFENDYLEGAHEKVLKRLVDTNLVQASGYGFDQFTAQAIEKIKDTIDC
    Newman          MLILVLGGNVVISFENDYLEGAHEKVLKRLVDTNLVQASGYGFDQFTAQAIEKIKDTIDC
    USA300_FPR3757  ----------MISFENDYLEGAHEKVLKRLVDTNLVQASGYGFDQFTAQAIEKIKDTIDC
                              :*************************************************

    COL             PNATIRFLVGGTQTNQVVINSMLESYEGVISADTGHVAVHEGGAIEYSGHKVITIPSKEG
    N315            PNATIRFLVGGTQTNQVVINSMLESYEGVISADTGHVAVHEGGAIEYSGHKVITIPSKEG
    NCTC8325        PNATIRFLVGGTQTNQVVINSMLESYEGVISADTGHVAVHEGGAIEYSGHKVITIPSKEG
    Newman          PNATIRFLVGGTQTNQVVINSMLESYEGVISADTGHVAVHEGGAIEYSGHKVITIPSKEG
    USA300_FPR3757  PNATIRFLVGGTQTNQVVINSMLESYEGVISADTGHVAVHEGGAIEYSGHKVITIPSKEG
                    ************************************************************

    COL             KVSASDVETYMETFKSDFKKDHMVFPGMVYISHPTEYGTLYSKSELEELCKVCKQYQLPL
    N315            KVSASDVETYMETFKSDFKKDHMVFPGMVYISHPTEYGTLYSKSELEELCKVCKQYQLPL
    NCTC8325        KVSASDVETYMETFKSDFKKDHMVFPGMVYISHPTEYGTLYSKSELEELCKVCKQYQLPL
    Newman          KVSASDVETYMETFKSDFKKDHMVFPGMVYISHPTEYGTLYSKSELEELCKVCKQYQLPL
    USA300_FPR3757  KVSASDVETYMETFKSDFKKDHMVFPGMVYISHPTEYGTLYSKSELEELCKVCKQYQLPL
                    ************************************************************

    COL             FMDGARLGYGLMSDQSDMTIKDIAKYCDVFYIGGTKIGALCGEAIVFTKNNEPKQFTTRI
    N315            FMDGARLGYGLMSDQSDMTIKDIAKYCDVFYIGGTKIGALCGEAIVFTKNNEPKQFTTRI
    NCTC8325        FMDGARLGYGLMSDQSDMTIKDIAKYCDVFYIGGTKIGALCGEAIVFTKNNEPKQFTTRI
    Newman          FMDGARLGYGLMSDQSDMTIKDIAKYCDVFYIGGTKIGALCGEAIVFTKNNEPKQFTTRI
    USA300_FPR3757  FMDGARLGYGLMSDQSDMTIKDIAKYCDVFYIGGTKIGALCGEAIVFTKNNEPKQFTTRI
                    ************************************************************

    COL             KHHGALLAKGRLTGIQFLELFTDNLYFNISRHAIEMANKMKDGFKNKGYRLYFDSPTNQQ
    N315            KHHGALLAKGRLTGIQFLELFTDNLYFNISRHAIEMANKMKDGFKNKGYRLYFDSPTNQQ
    NCTC8325        KHHGALLAKGRLTGIQFLELFTDNLYFNISRHAIEMANKMKDGFKNKGYRLYFDSPTNQQ
    Newman          KHHGALLAKGRLTGIQFLELFTDNLYFNISRHAIEMANKMKDGFKNKGYRLYFDSPTNQQ
    USA300_FPR3757  KHHGALLAKGRLTGIQFLELFTDNLYFNISRHAIEMANKMKDGFKNKGYRLYFDSPTNQQ
                    ************************************************************

    COL             FFILSNEKIAELEQKVKFAVWEKYDDQHRVVRFATSWATTEENLNKLLELI
    N315            FFILSNEKIAELEQKVKFAVWEKYDDQHRVVRFATSWATTEENLNKLLELI
    NCTC8325        FFILSNEKIAELEQKVKFAVWEKYDDQHRVVRFATSWATTEENLNKLLELI
    Newman          FFILSNEKIAELEQKVKFAVWEKYDDQHRVVRFATSWATTEENLNKLLELI
    USA300_FPR3757  FFILSNEKIAELEQKVKFAVWEKYDDQHRVVRFATSWATTEENLNKLLELI
                    ***************************************************