From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003689000
  • symbol?:
  • description?: sensor kinase

      descriptions from strain specific annotations:

    • sensor kinase
    • sensor histidine kinase
    • sensor kinase protein
    • two-component sensor histidine kinase
    • integral membrane sensor signal transduction histidine kinase
    • histidine kinase dimerisation and phosphoacceptor region
    • sensor histidine kinase, putative
    • histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family protein
    • putative sensor histidine kinase
  • strand?: +
  • coordinates?: 3995848..3997002
  • synteny block?: BlockID0027550
  • occurrence?: in 75% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1276
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ECTR2_1180
    ED133:
    ED98:
    SAAV_1300
    HO 5096 0412:
    SAEMRSA15_11680
    JH1:
    SaurJH1_1409
    JH9:
    SaurJH9_1382
    JKD6008:
    SAA6008_01285
    JKD6159:
    SAA6159_01188
    LGA251:
    M013:
    MRSA252:
    SAR1331
    MSHR1132:
    SAMSHR1132_11660
    MSSA476:
    SAS1261
    Mu3:
    SAHV_1310
    Mu50:
    SAV1321
    MW2:
    MW1208
    RF122:
    ST398:
    T0131:
    SAT0131_01389
    TCH60:
    HMPREF0772_11887
    TW20:
    SATW20_13230
    USA300_TCH1516:
    USA300HOU_1265
    VC40:
    SAVC_05845

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKFLKDTSIAEISSILYLIFPIAGIFFNEVYGPKWLYIISVIVFSLSYLILVIVNNRLNT
    N315            MKFLKDTSIAEISSILYLIFPIAGIFFNEVYGPKWLYIISVIVFSLSYLILVIVNNRLNT
    NCTC8325        MKFLKDTSIAEISSILYLIFPIAGIFFNEVYGPKWLYIISVIVFSLSYLILVIVNNRLNT
    Newman          MKFLKDTSIAEISSILYLIFPIAGIFFNEVYGPKWLYIISVIVFSLSYLILVIVNNRLNT
    USA300_FPR3757  MKFLKDTSIAEISSIVYLIFPIAGIFFNEVYGPKWLYIISVIVFSLSYLILVIVNNRLNT
                    ***************:********************************************

    COL             LMFYILLIIHYFIICYFVFSVHPMLSLFFFYSAFAVPFTFKNNVKKTATNLFILTMIICT
    N315            LMFYILLIIHYFIICYFVFSVHPMLSLFFFYSAFAVPFTFKNNVKKTATNLFILTMIICT
    NCTC8325        LMFYILLIIHYFIICYFVFSVHPMLSLFFFYSAFAVPFTFKNNVKKTATNLFILTMIICT
    Newman          LMFYILLIIHYFIICYFVFSVHPMLSLFFFYSAFAVPFTFKNNVKKTATNLFILTMIICT
    USA300_FPR3757  LMFYILLIIHYFIICYFVFSVHPMLSLFFFYSAFAVPFTFKNNVKKTATNLFILTMIICT
                    ************************************************************

    COL             IITYLLYNNYFVAMMVYYVVISLIMLDNFKKMKNREYQKEIAEKNRHINTLIAEQERHRI
    N315            IITYLLYNNYFVAMMVYYVVISLIMLDNFKKMKNREYQKEIAEKNRHINTLIAEQERHRI
    NCTC8325        IITYLLYNNYFVAMMVYYVVISLIMLDNFKKMKNREYQKEIAEKNRHINTLIAEQERHRI
    Newman          IITYLLYNNYFVAMMVYYVVISLIMLDNFKKMKNREYQKEIAEKNRHINTLIAEQERHRI
    USA300_FPR3757  IITYLLYNNYFVAMMVYYVVISLIMLDNFKKMKNREYQKEIAEKNRHINTLIAEQERHRI
                    ************************************************************

    COL             GQDLHDTLGHVFASLSLKSELAYKLIDADVEKVKAELLAINKLSRESLNKVREIIDDVKL
    N315            GQDLHDTLGHVFASLSLKSELAYKLIDTDVEKVKAELLAINKLSRESLNKVREIIDDVKL
    NCTC8325        GQDLHDTLGHVFASLSLKSELAYKLIDADVEKVKAELLAINKLSRESLNKVREIIDDVKL
    Newman          GQDLHDTLGHVFASLSLKSELAYKLIDADVEKVKAELLAINKLSRESLNKVREIIDDVKL
    USA300_FPR3757  GQDLHDTLGHVFASLSLKSELAYKLIDADVEKVKAELLAINKLSRESLNKVREIIDDVKL
                    ***************************:********************************

    COL             PSFIEEIDSIRKVLKDADIDFTFENKELAQVLSPTKQSMLVMITREAINNVIKHANASKV
    N315            PSFIEEIDSIRKVLKDADIDFTFENKELAQVLSPTKQSMLVMITREAINNVIKHANASKV
    NCTC8325        PSFIEEIDSIRKVLKDADIDFTFENKELAQVLSPTKQSMLVMITREAINNVIKHANASKV
    Newman          PSFIEEIDSIRKVLKDADIDFTFENKELAQVLSPTKQSMLVMITREAINNVIKHANASKV
    USA300_FPR3757  PSFIEEIDSIRKVLKDADIDFTFENKELAQVLSPTKQSMLVMITREAINNVIKHANASKV
                    ************************************************************

    COL             HGKLKTVNNHKLLLMIEDDGKGIDSDCEVKSISQRVQHLNGTLAVDSTNGTKIIIEISTG
    N315            HGKLKTVNNHKLLLMIEDDGKGIDSDCEVKSISQRVQHLNGTLAVDSTNGTKIIIEISTG
    NCTC8325        HGKLKTVNNHKLLLMIEDDGKGIDSDCEVKSISQRVQHLNGTLAVDSTNGTKIIIEISTG
    Newman          HGKLKTVNNHKLLLMIEDDGKGIDSDCEVKSISQRVQHLNGTLAVDSTNGTKIIIEISTG
    USA300_FPR3757  HGKLKTVNNHKLLLMIEDDGKGIDSDCEVKSISQRVQHLNGTLAVDSTNGTKIIIEISTG
                    ************************************************************

    COL             GIA
    N315            GIA
    NCTC8325        GIA
    Newman          GIA
    USA300_FPR3757  GIA
                    ***