From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003702000
  • symbol?: thrB
  • description?: homoserine kinase

      descriptions from strain specific annotations:

    • homoserine kinase
    • homoserine kinase, ThrB
  • strand?: +
  • coordinates?: 4006658..4007617
  • synteny block?: BlockID0027680
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1364 (thrB)
    N315:
    SA1166 (thrB)
    NCTC8325:
    Newman:
    NWMN_1242 (thrB)
    USA300_FPR3757:
    04-02981:
    SA2981_1285 (thrB)
    08BA02176:
    C248_1365 (thrB)
    11819-97:
    MS7_1289 (thrB)
    71193:
    ST398NM01_1332
    ECT-R 2:
    ECTR2_1189 (thrB)
    ED133:
    SAOV_1343 (thrB)
    ED98:
    SAAV_1310 (thrB)
    HO 5096 0412:
    SAEMRSA15_11770 (thrB)
    JH1:
    SaurJH1_1418
    JH9:
    SaurJH9_1391
    JKD6008:
    SAA6008_01296 (thrB)
    JKD6159:
    SAA6159_01197 (thrB)
    LGA251:
    SARLGA251_12390 (thrB)
    M013:
    M013TW_1278
    MRSA252:
    SAR1340 (thrB)
    MSHR1132:
    SAMSHR1132_11750
    MSSA476:
    SAS1270
    Mu3:
    SAHV_1319 (thrB)
    Mu50:
    SAV1330 (thrB)
    MW2:
    MW1217 (thrB)
    RF122:
    SAB1188 (thrB)
    ST398:
    SAPIG1332 (thrB)
    T0131:
    SAT0131_01401
    TCH60:
    HMPREF0772_11878 (thrB)
    TW20:
    SATW20_13320 (thrB)
    USA300_TCH1516:
    USA300HOU_1275 (thrB)
    VC40:
    SAVC_05890

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSNVLELTIPASTANLGVGFDSIGMALDKFLHLSVKETSGTKWEYIFHDDASKQLPTDET
    N315            MSNVLELTIPASTANLGVGFDSIGMALDKFLHLSVKETSGTKWEYIFHDDASKQLPTDET
    NCTC8325        MSNVLELTIPASTANLGVGFDSIGMALDKFLHLSVKETSGTKWEYIFHDDASKQLPTDET
    Newman          MSNVLELTIPASTANLGVGFDSIGMALDKFLHLSVKETSGTKWEYIFHDDASKQLPTDET
    USA300_FPR3757  MSNVLELTIPASTANLGVGFDSIGMALDKFLHLSVKETSGTKWEYIFHDDASKQLPTDET
                    ************************************************************

    COL             NFIYHVAQQVASKYSVDLPNLCIEMRSDIPLARGLGSSASALVGAIYIANYFGDIQLSKH
    N315            NFIYHVAQQVASKYSVDLPILCIEMRSDIPLARGLGSSASALVGAIYIANYFGDIQLSKH
    NCTC8325        NFIYHVAQQVASKYSVDLPNLCIEMRSDIPLARGLGSSASALVGAIYIANYFGDIQLSKH
    Newman          NFIYHVAQQVASKYSVDLPNLCIEMRSDIPLARGLGSSASALVGAIYIANYFGDIQLSKH
    USA300_FPR3757  NFIYHVAQQVASKYSVDLPNLCIEMRSDIPLARGLGSSASALVGAIYIANYFGDIQLSKH
                    ******************* ****************************************

    COL             EVLQLATEIEGHPDNVAPTIYGGLIAGYYNDVSKETSVAHIDIPDVDVIVTIPTYELKTE
    N315            EVLQLATEIEGHPDNVAPTIYGGLIAGFYNDVSKETSVAHIDIPDVDVIVTIPTYELKTE
    NCTC8325        EVLQLATEIEGHPDNVAPTIYGGLIAGYYNDVSKETSVAHIDIPDVDVIVTIPTYELKTE
    Newman          EVLQLATEIEGHPDNVAPTIYGGLIAGYYNDVSKETSVAHIDIPDVDVIVTIPTYELKTE
    USA300_FPR3757  EVLQLATEIEGHPDNVAPTIYGGLIAGYYNDVSKETSVAHIDIPDVDVIVTIPTYELKTE
                    ***************************:********************************

    COL             ASRRALPQKLTHSEAVKSSAISNTMICALAQHNYELAGKLMQQDGFHEPYRQHLIAEFDE
    N315            ASRRALPQKLTHSEAVKSSAISNTMICALAQHNYELAGKLMQQDGFHEPYRQHLIAEFDE
    NCTC8325        ASRRALPQKLTHSEAVKSSAISNTMICALAQHNYELAGKLMQQDGFHEPYRQHLIAEFDE
    Newman          ASRRALPQKLTHSEAVKSSAISNTMICALAQHNYELAGKLMQQDGFHEPYRQHLIAEFDE
    USA300_FPR3757  ASRRALPQKLTHSEAVKSSAISNTMICALAQHNYELAGKLMQQDGFHEPYRQHLIAEFDE
                    ************************************************************

    COL             VKTIASQHNAYATVISGAGPTILIFSRKENSGELVRSLNSQVVSCHSELVDINISGVKER
    N315            VKTIASQHNAYATVISGAGPTILIFSRKENSGELVRSLNSQVVSCHSELVDINISGVKER
    NCTC8325        VKTIASQHNAYATVISGAGPTILIFSRKENSGELVRSLNSQVVSCHSELVDINISGVKER
    Newman          VKTIASQHNAYATVISGAGPTILIFSRKENSGELVRSLNSQVVSCHSELVDINISGVKER
    USA300_FPR3757  VKTIASQHNAYATVISGAGPTILIFSRKENSGELVRSLNSQVVSCHSELVDINISGVKER
                    ************************************************************

    COL             IVYQ
    N315            IVYQ
    NCTC8325        IVYQ
    Newman          IVYQ
    USA300_FPR3757  IVYQ
                    ****