Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003709000
  • symbol?: rpsN2
  • description?: 30S ribosomal protein S14

      descriptions from strain specific annotations:

    • 30S ribosomal protein S14
    • 30S ribosomal protein S14p
    • ribosomal protein S14p/S29e family protein
    • alternate 30S ribosomal protein S14
  • strand?: +
  • coordinates?: 4013743..4014012
  • synteny block?: BlockID0027750
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1370 (rpsN)
    N315:
    SA1171 (rpsN)
    NCTC8325:
    Newman:
    NWMN_1248 (rpsN)
    USA300_FPR3757:
    04-02981:
    SA2981_1291 (rpsN)
    08BA02176:
    C248_1372
    11819-97:
    MS7_1295 (rpsN2)
    71193:
    ST398NM01_1338
    ECT-R 2:
    ECTR2_1195
    ED133:
    SAOV_1349 (rpsN)
    ED98:
    SAAV_1316 (rpsN)
    HO 5096 0412:
    SAEMRSA15_11830
    JH1:
    SaurJH1_1424 (rpsN)
    JH9:
    SaurJH9_1397 (rpsN)
    JKD6008:
    SAA6008_01302 (rpsN_1)
    JKD6159:
    SAA6159_01203 (rpsN_1)
    LGA251:
    SARLGA251_12450
    M013:
    M013TW_1284
    MRSA252:
    SAR1346 (rpsN)
    MSHR1132:
    SAMSHR1132_11810
    MSSA476:
    SAS1276 (rpsN)
    Mu3:
    SAHV_1325 (rpsN)
    Mu50:
    SAV1336 (rpsN)
    MW2:
    MW1223 (rpsN)
    RF122:
    SAB1194 (rpsN)
    ST398:
    SAPIG1338
    T0131:
    SAT0131_01407
    TCH60:
    HMPREF0772_11872 (rpsN2)
    TW20:
    SATW20_13380
    USA300_TCH1516:
    VC40:
    SAVC_05920 (rpsN)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKKSKIAKERKREELVNKYYELRKELKAKGDYEALRKLPRDSSPTRLTRRCKVTGRPRG
    N315            MAKKSKIAKERKREELVNKYYELRKELKAKGDYEALRKLPRDSSPTRLTRRCKVTGRPRG
    NCTC8325        MAKKSKIAKERKREELVNKYYELRKELKAKGDYEALRKLPRDSSPTRLTRRCKVTGRPRG
    Newman          MAKKSKIAKERKREELVNKYYELRKELKAKGDYEALRKLPRDSSPTRLTRRCKVTGRPRG
    USA300_FPR3757  MAKKSKIAKERKREELVNKYYELRKELKAKGDYEALRKLPRDSSPTRLTRRCKVTGRPRG
                    ************************************************************

    COL             VLRKFEMSRIAFREHAHKGQIPGVKKSSW
    N315            VLRKFEMSRIAFREHAHKGQIPGVKKSSW
    NCTC8325        VLRKFEMSRIAFREHAHKGQIPGVKKSSW
    Newman          VLRKFEMSRIAFREHAHKGQIPGVKKSSW
    USA300_FPR3757  VLRKFEMSRIAFREHAHKGQIPGVKKSSW
                    *****************************