From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003712000
  • symbol?:
  • description?: secretion protein

      descriptions from strain specific annotations:

    • secretion protein
    • cysteine-rich secretory family protein
    • pseudogene
    • SCP family extracellular protein
    • SCP-like extracellular family protein
    • SCP-like extracellular protein
  • strand?: +
  • coordinates?: 4015170..4016186
  • synteny block?: BlockID0027780
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1293
    08BA02176:
    C248_1374
    11819-97:
    MS7_1297
    71193:
    ST398NM01_1340
    ECT-R 2:
    ECTR2_1197
    ED133:
    SAOV_1351
    ED98:
    SAAV_1319
    HO 5096 0412:
    SAEMRSA15_11850
    JH1:
    SaurJH1_1426
    JH9:
    SaurJH9_1399
    JKD6008:
    SAA6008_01304
    JKD6159:
    SAA6159_01205
    LGA251:
    SARLGA251_12470
    M013:
    M013TW_1286
    MRSA252:
    SAR1348
    MSHR1132:
    SAMSHR1132_11830
    MSSA476:
    SAS1278
    Mu3:
    SAHV_1327
    Mu50:
    SAV1338
    MW2:
    MW1225
    RF122:
    SAB1196
    ST398:
    SAPIG1340
    T0131:
    SAT0131_01409 (narI)
    TCH60:
    HMPREF0772_11870
    TW20:
    SATW20_13400
    USA300_TCH1516:
    VC40:
    SAVC_05930

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---------------------------------------------------MDTPKKQQF
    N315            MKKFIVTVVAFLSIIIIAPITEFKPFIHLQNEVRQYIDIHINKETISAENKLDTPKKQQF
    NCTC8325        ---------------------------------------------------MDTPKKQQF
    Newman          ---------------------------------------------------MDTPKKQQF
    USA300_FPR3757  ---------------------------------------------------MDTPKKQQF
                                                                       :********

    COL             AFNNIQMNMSKSDVEKTLNKPKRVTFNEYGTKWYTYYDDDYNNFIMISYMKDKVNALYTN
    N315            AFNNIQMNMSKSDVEKTLNKPKRVTFNEYGTKWYTYYDDDYNNFIMISYMKDKVNALYTN
    NCTC8325        AFNNIQMNMSKSDVEKTLNKPKRVTFNEYGTKWYTYYDDDYNNFIMISYMKDKVNALYTN
    Newman          AFNNIQMNMSKSDVEKTLNKPKRVTFNEYGTKWYTYYDDDYNNFIMISYMKDKVNALYTN
    USA300_FPR3757  AFNNIQMNMSKSDVEKTLNKPKRVTFNEYGTKWYTYYDDDYNNFIMISYMKDKVNALYTN
                    ************************************************************

    COL             QNIITSKSKIKYNTPKSVVRQRLGEPETEIVKGRVRYEQNNKEYDVFHKNHIYTTVFYDK
    N315            QNIITSKSKIKYNTPKSVVRQRLGEPETEIVKGRVRYEQNNKEYDVFHKNHIYTTVFYDK
    NCTC8325        QNIITSKSKIKYNTPKSVVRQRLGEPETEIVKGRVRYEQNNKEYDVFHKNHIYTTVFYDK
    Newman          QNIITSKSKIKYNTPKSVVRQRLGEPETEIVKGRVRYEQNNKEYDVFHKNHIYTTVFYDK
    USA300_FPR3757  QNIITSKSKIKYNTPKSVVRQRLGEPETEIVKGRVRYEQNNKEYDVFHKNHIYTTVFYDK
                    ************************************************************

    COL             HRRNNVTAVLQVSDAMENRLKEQYGAPSKSLADSFELQNFDLVNAERKQHQLSTLKYSKQ
    N315            HRRNNVTAVLQVSDAMENRLKEQYGAPSKSLADSFELQNFDLVNAERKQHQLSTLKYSKQ
    NCTC8325        HRRNNVTAVLQVSDAMENRLKEQYGAPSKSLADSFELQNFDLVNAERKQHQLSTLKYSKQ
    Newman          HRRNNVTAVLQVSDAMENRLKEQYGAPSKSLADSFELQNFDLVNAERKQHQLSTLKYSKQ
    USA300_FPR3757  HRRNNVTAVLQVSDAMENRLKEQYGAPSKSLADSFELQNFDLVNAERKQHQLSTLKYSKQ
                    ************************************************************

    COL             NSETARKHSKDMANNHYFDHTNLKGQSPFDRLKKDGITFNSAGENLAYGQVSSIYAHQGL
    N315            NSETARKHSKDMAKNHYFDHTNLKGQSPFDRLKKDGITFNSAGENLAYGQVSSIYAHQGL
    NCTC8325        NSETARKHSKDMANNHYFDHTNLKGQSPFDRLKKDGITFNSAGENLAYGQVSSIYAHQGL
    Newman          NSETARKHSKDMANNHYFDHTNLKGQSPFDRLKKDGITFNSAGENLAYGQVSSIYAHQGL
    USA300_FPR3757  NSETARKHSKDMANNHYFDHTNLKGQSPFDRLKKDGITFNSAGENLAYGQVSSIYAHQGL
                    *************:**********************************************

    COL             MNSIGHRKNILNDTFKILGVGVDFNDEKQPFWTENYTG
    N315            MNSIGHRKNILNDTFKILGVGVDFNDEKQPFWTENYTG
    NCTC8325        MNSIGHRKNILNDTFKILGVGVDFNDEKQPFWTENYTG
    Newman          MNSIGHRKNILNDTFKILGVGVDFNDEKQPFWTENYTG
    USA300_FPR3757  MNSIGHRKNILNDTFKILGVGVDFNDEKQPFWTENYTG
                    **************************************