From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003727000
  • symbol?: mscL
  • description?: large-conductance mechanosensitive channel

      descriptions from strain specific annotations:

    • large-conductance mechanosensitive channel
    • large conductance mechanosensitive channel protein
    • pseudogene
  • strand?: -
  • coordinates?: 4027354..4027723
  • synteny block?: BlockID0027920
  • occurrence?: in 94% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1383 (mscL)
    N315:
    SA1182 (mscL)
    NCTC8325:
    Newman:
    NWMN_1260 (mscL)
    USA300_FPR3757:
    04-02981:
    SA2981_1302 (mscL)
    08BA02176:
    C248_1383 (mscL)
    11819-97:
    MS7_1306 (mscL)
    71193:
    ST398NM01_1349
    ECT-R 2:
    ECTR2_1206 (mscL)
    ED133:
    SAOV_1360c
    ED98:
    SAAV_1328 (mscL)
    HO 5096 0412:
    SAEMRSA15_11940 (mscL)
    JH1:
    SaurJH1_1436 (mscL)
    JH9:
    SaurJH9_1409 (mscL)
    JKD6008:
    SAA6008_01313 (mscL)
    JKD6159:
    SAA6159_01214 (mscL)
    LGA251:
    SARLGA251_12560 (mscL)
    M013:
    M013TW_1295
    MRSA252:
    SAR1360 (mscL)
    MSHR1132:
    SAMSHR1132_11920
    MSSA476:
    SAS1287 (mscL)
    Mu3:
    SAHV_1336 (mscL)
    Mu50:
    SAV1347 (mscL)
    MW2:
    MW1235 (mscL)
    RF122:
    SAB1205c (mscL)
    ST398:
    SAPIG1349 (mscL)
    T0131:
    SAT0131_01419
    TCH60:
    HMPREF0772_11861 (mscL)
    TW20:
    SATW20_13490 (mscL)
    USA300_TCH1516:
    VC40:
    SAVC_05975 (mscL)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -------------------------MLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLV
    N315            -------------------------MLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLV
    Newman          -------------------------MLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLV
    USA300_FPR3757  MNNLFSNFFICCIIEVTFKKERLSVMLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLV
                                             ***********************************

    COL             ENIIMPLIGKIFGSVDFAKEWSFWGIKYGLFIQSVIDFIIIAFALFIFVKIANTLMKKEE
    N315            ENIIMPLIGKIFGSVDFAKEWSFWGIKYGLFIQSVIDFIIIAFALFIFVKIANTLMKKEE
    Newman          ENIIMPLIGKIFGSVDFAKEWSFWGIKYGLFIQSVIDFIIIAFALFIFVKIANTLMKKEE
    USA300_FPR3757  ENIIMPLIGKIFGSVDFAKEWSFWGIKYGLFIQSVIDFIIIAFALFIFVKIANTLMKKEE
                    ************************************************************

    COL             AEEEAVVEENVVLLTEIRDLLREKK
    N315            AEEEAVVEENVVLLTEIRDLLREKK
    Newman          AEEEAVVEENVVLLTEIRDLLREKK
    USA300_FPR3757  AEEEAVVEENVVLLTEIRDLLREKK
                    *************************