From AureoWiki
Jump to: navigation, search

NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1244 [new locus tag: SAUSA300_RS06755 ]
  • pan locus tag?: SAUPAN003727000
  • symbol: mscL
  • pan gene symbol?: mscL
  • synonym:
  • product: large-conductance mechanosensitive channel

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_1244 [new locus tag: SAUSA300_RS06755 ]
  • symbol: mscL
  • product: large-conductance mechanosensitive channel
  • replicon: chromosome
  • strand: -
  • coordinates: 1364027..1364464
  • length: 438
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    TTGAATAATCTATTTTCTAATTTTTTTATTTGTTGTATAATTGAGGTTACATTTAAAAAA
    GAGAGGTTGAGTGTAATGTTAAAAGAATTCAAAGAGTTCGCCTTAAAAGGTAACGTCTTA
    GATTTAGCAATTGCTGTTGTGATGGGTGCAGCTTTCAACAAGATTATATCTTCATTAGTA
    GAAAATATCATTATGCCATTAATTGGTAAAATTTTCGGATCAGTTGATTTTGCTAAAGAA
    TGGTCATTCTGGGGTATTAAATACGGTTTATTTATCCAATCTGTTATCGACTTTATTATC
    ATCGCGTTTGCTTTATTCATCTTTGTTAAGATTGCAAATACATTAATGAAGAAAGAAGAA
    GCCGAAGAAGAAGCAGTTGTGGAAGAAAATGTTGTGTTATTAACTGAAATCAGAGATTTA
    TTACGTGAGAAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    438

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_1244 [new locus tag: SAUSA300_RS06755 ]
  • symbol: MscL
  • description: large-conductance mechanosensitive channel
  • length: 145
  • theoretical pI: 5.00215
  • theoretical MW: 16594.7
  • GRAVY: 0.637931

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesAdaptations to atypical conditionslarge conductance mechanosensitive channel protein (TIGR00220; HMM-score: 125.9)
  • TheSEED:  
    Potassium metabolismPotassium metabolism - no subcategoryGlutathione-regulated potassium-efflux system and associated functions Large-conductance mechanosensitive channel 
    and 1 more
    Potassium metabolism - no subcategoryPotassium homeostasis Large-conductance mechanosensitive channel 
  • PFAM:
    no clan definedMscL; Large-conductance mechanosensitive channel, MscL (PF01741; HMM-score: 135.4)
    and 1 more
    Anoctamin-like (CL0416) Anoctamin; Calcium-activated chloride channel (PF04547; HMM-score: 11.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helix: 1
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.14
    • Ymax_pos: 20
    • Cmax: 0.112
    • Cmax_pos: 51
    • Smax: 0.236
    • Smax_pos: 11
    • Smean: 0.179
    • D: 0.155
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNNLFSNFFICCIIEVTFKKERLSVMLKEFKEFALKGNVLDLAIAVVMGAAFNKIISSLVENIIMPLIGKIFGSVDFAKEWSFWGIKYGLFIQSVIDFIIIAFALFIFVKIANTLMKKEEAEEEAVVEENVVLLTEIRDLLREKK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • mscL no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]