From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003746000
  • symbol?: glcT
  • description?: transcription antiterminator

      descriptions from strain specific annotations:

    • transcription antiterminator
    • protein GlcT
    • BglG family transcription antiterminator
    • CAT RNA-binding domain-containing protein
    • CAT RNA binding domain protein
    • PRD domain-containing protein
    • transcriptional antiterminator
  • strand?: +
  • coordinates?: 4045979..4046839
  • synteny block?: BlockID0028090
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1191 (glcT)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1311 (glcT)
    08BA02176:
    C248_1394
    11819-97:
    MS7_1315
    71193:
    ST398NM01_1359
    ECT-R 2:
    ECTR2_1215
    ED133:
    SAOV_1369
    ED98:
    SAAV_1338
    HO 5096 0412:
    SAEMRSA15_12050
    JH1:
    SaurJH1_1446
    JH9:
    SaurJH9_1419
    JKD6008:
    SAA6008_01323 (glcT)
    JKD6159:
    SAA6159_01223 (glcT)
    LGA251:
    SARLGA251_12670
    M013:
    M013TW_1304
    MRSA252:
    SAR1369
    MSHR1132:
    SAMSHR1132_12010
    MSSA476:
    SAS1297
    Mu3:
    SAHV_1345 (glcT)
    Mu50:
    SAV1357 (glcT)
    MW2:
    MW1244 (glcT)
    RF122:
    SAB1214
    ST398:
    SAPIG1359
    T0131:
    SAT0131_01428
    TCH60:
    HMPREF0772_11852 (glcT)
    TW20:
    SATW20_13580
    USA300_TCH1516:
    USA300HOU_1291 (glcT)
    VC40:
    SAVC_06030

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MGEYIVTKTLNNNVVVCTNNDQEVILIGKGIGFNKKEGMALNDQTITIEKIYKLESE
    N315            ---MGEYIVTKTLNNNVVVCTNNDQEVILIGKGIGFNKKEGMALNDQTITIEKIYKLESE
    NCTC8325        ---MGEYIVTKTLNNNVVVCTNNDQEVILIGKGIGFNKKEGMALNDQTITIEKIYKLESE
    Newman          ---MGEYIVTKTLNNNVVVCTNNDQEVILIGKGIGFNKKEGMALNDQTITIEKIYKLESE
    USA300_FPR3757  MMIMGEYIVTKTLNNNVVVCTNNDQEVILIGKGIGFNKKEGMALNDQTITIEKIYKLESE
                       *********************************************************

    COL             QQKAHYKSLVEIADDNVLQVIIDSLNFISNTAMNVDSKQLVVSLTDHIIFAYKRLKQNQV
    N315            QQKAHYKSLVEIADDNVLQVIIDSLNFISNTAMNVDSKQLVVSLTDHIIFAYKRLKQNQV
    NCTC8325        QQKAHYKSLVEIADDNVLQVIIDSLNFISNTAMNVDSKQLVVSLTDHIIFAYKRLKQNQV
    Newman          QQKAHYKSLVEIADDNVLQVIIDSLNFISNTAMNVDSKQLVVSLTDHIIFAYKRLKQNQV
    USA300_FPR3757  QQKAHYKSLVEIADDNVLQVIIDSLNFISNTAMNVDSKQLVVSLTDHIIFAYKRLKQNQV
                    ************************************************************

    COL             ISNPFVMETMQLYSDAYHIAKQVIDQLNAALDVHFPEDEIGFIALHIASNTEDLSMHEMT
    N315            ISNPFVMETMQLYSDAYHIAKQVIDQLNAALDVHFPEDEIGFIALHIASNTEDLSMHEMT
    NCTC8325        ISNPFVMETMQLYSDAYHIAKQVIDQLNAALDVHFPEDEIGFIALHIASNTEDLSMHEMT
    Newman          ISNPFVMETMQLYSDAYHIAKQVIDQLNAALDVHFPEDEIGFIALHIASNTEDLSMHEMT
    USA300_FPR3757  ISNPFVMETMQLYSDAYHIAKQVIDQLNAALDVHFPEDEIGFIALHIASNTEDLSMHEMT
                    ************************************************************

    COL             LINNVIKKGIDIIESDLVTTVDKESLQYQRFIRHVQFLIRRLRRKEYIHAQDDFVSMIKN
    N315            LINNVIKKGIDIIESDLVTTVDKESLQYQRFIRHVQFLIRRLRRKEYIHAQDDFVSMIKN
    NCTC8325        LINNVIKKGIDIIESDLVTTVDKESLQYQRFIRHVQFLIRRLRRKEYIHAQDDFVSMIKN
    Newman          LINNVIKKGIDIIESDLVTTVDKESLQYQRFIRHVQFLIRRLRRKEYIHAQDDFVSMIKN
    USA300_FPR3757  LINNVIKKGIDIIESDLVTTVDKESLQYQRFIRHVQFLIRRLRRKEYIHAQDDFVSMIKN
                    ************************************************************

    COL             HYPICYNTAYKILTMIQKQFDVNISESEIIYLTLHIHHFEERINQS
    N315            HYPICYNTAYKILTMIQKQFDVNISESEIIYLTLHIHHFEERINQS
    NCTC8325        HYPICYNTAYKILTMIQKQFDVNISESEIIYLTLHIHHFEERINQS
    Newman          HYPICYNTAYKILTMIQKQFDVNISESEIIYLTLHIHHFEERINQS
    USA300_FPR3757  HYPICYNTAYKILTMIQKQFDVNISESEIIYLTLHIHHFEERINQS
                    **********************************************