From AureoWiki
Jump to: navigation, search

NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1253 [new locus tag: SAUSA300_RS06805 ]
  • pan locus tag?: SAUPAN003746000
  • symbol: glcT
  • pan gene symbol?: glcT
  • synonym:
  • product: transcription antiterminator

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_1253 [new locus tag: SAUSA300_RS06805 ]
  • symbol: glcT
  • product: transcription antiterminator
  • replicon: chromosome
  • strand: +
  • coordinates: 1378770..1379630
  • length: 861
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    GTGATGATAATGGGAGAATATATTGTTACTAAAACATTGAACAACAATGTCGTAGTATGT
    ACTAATAATGATCAAGAAGTTATTTTAATCGGTAAAGGTATTGGTTTTAACAAAAAAGAG
    GGAATGGCGTTAAACGACCAAACTATTACAATAGAGAAAATTTATAAATTAGAAAGTGAG
    CAACAAAAAGCACATTATAAAAGTTTAGTTGAAATCGCTGATGATAATGTATTACAAGTA
    ATTATTGATTCGTTGAATTTTATTTCTAATACTGCGATGAATGTTGATTCAAAACAACTT
    GTAGTTTCATTAACGGATCATATTATATTTGCTTATAAACGCTTAAAACAAAATCAAGTT
    ATTAGCAATCCATTTGTTATGGAAACTATGCAGTTATATAGTGATGCATATCATATTGCT
    AAACAGGTGATTGATCAGTTAAATGCAGCATTAGATGTACATTTTCCTGAAGATGAGATA
    GGATTTATTGCATTACATATTGCATCTAATACAGAAGATTTATCTATGCATGAGATGACC
    TTGATCAATAATGTTATTAAAAAAGGTATAGATATCATTGAATCAGACCTTGTGACAACT
    GTTGATAAGGAATCATTACAATACCAACGTTTTATAAGGCACGTACAATTTTTAATTCGC
    CGATTAAGAAGAAAAGAATATATACATGCACAAGATGATTTTGTGTCTATGATTAAAAAT
    CACTATCCGATTTGCTATAACACAGCATATAAAATTTTAACTATGATACAAAAACAATTT
    GATGTTAATATCAGTGAGTCTGAAATTATATATTTAACATTACACATTCATCATTTTGAA
    GAAAGGATTAATCAATCCTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    861

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_1253 [new locus tag: SAUSA300_RS06805 ]
  • symbol: GlcT
  • description: transcription antiterminator
  • length: 286
  • theoretical pI: 5.9112
  • theoretical MW: 33198
  • GRAVY: -0.135664

Function[edit source | edit]

  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersRiboflavin, FMN, and FADGTP cyclohydrolase II (TIGR00505; EC 3.5.4.25; HMM-score: 12.3)
  • TheSEED:  
    Beta-glucoside bgl operon antiterminator, BglG family 
  • PFAM:
    PRD (CL0166) PRD; PRD domain (PF00874; HMM-score: 142.3)
    and 4 more
    no clan definedCAT_RBD; CAT RNA binding domain (PF03123; HMM-score: 70)
    DUF4956; Domain of unknown function (DUF4956) (PF16316; HMM-score: 13.8)
    Dioxygenase_N; Catechol dioxygenase N terminus (PF04444; HMM-score: 12.8)
    HTH (CL0123) FokI_C; Restriction endonuclease FokI, catalytic domain (PF02980; HMM-score: 12.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.152
    • Ymax_pos: 11
    • Cmax: 0.114
    • Cmax_pos: 24
    • Smax: 0.289
    • Smax_pos: 2
    • Smean: 0.224
    • D: 0.18
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MMIMGEYIVTKTLNNNVVVCTNNDQEVILIGKGIGFNKKEGMALNDQTITIEKIYKLESEQQKAHYKSLVEIADDNVLQVIIDSLNFISNTAMNVDSKQLVVSLTDHIIFAYKRLKQNQVISNPFVMETMQLYSDAYHIAKQVIDQLNAALDVHFPEDEIGFIALHIASNTEDLSMHEMTLINNVIKKGIDIIESDLVTTVDKESLQYQRFIRHVQFLIRRLRRKEYIHAQDDFVSMIKNHYPICYNTAYKILTMIQKQFDVNISESEIIYLTLHIHHFEERINQS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]