From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003796000
  • symbol?: pstC
  • description?: phosphate ABC transporter permease

      descriptions from strain specific annotations:

    • phosphate ABC transporter permease
    • Phosphate transport system permease protein pstC
    • phosphate ABC transporter permease PstC
    • phosphate ABC transporter ATP-binding protein
    • phosphate ABC superfamily ATP binding cassette transporter, membrane protein
    • phosphate ABC transporter, permease protein PstC
  • strand?: -
  • coordinates?: 4089847..4090773
  • synteny block?: BlockID0028530
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1342 (pstC)
    08BA02176:
    C248_1427
    11819-97:
    MS7_1345 (pstC)
    71193:
    ST398NM01_1389
    ECT-R 2:
    ECTR2_1245 (pstC)
    ED133:
    SAOV_1397c
    ED98:
    SAAV_1370
    HO 5096 0412:
    SAEMRSA15_12520
    JH1:
    SaurJH1_1478
    JH9:
    SaurJH9_1449
    JKD6008:
    SAA6008_01352 (pstC)
    JKD6159:
    SAA6159_01255 (pstC)
    LGA251:
    SARLGA251_13050
    M013:
    M013TW_1333
    MRSA252:
    SAR1401
    MSHR1132:
    SAMSHR1132_12300
    MSSA476:
    SAS1329
    Mu3:
    SAHV_1376
    Mu50:
    SAV1388
    MW2:
    MW1276
    RF122:
    SAB1244c
    ST398:
    SAPIG1389 (pstC)
    T0131:
    SAT0131_01461
    TCH60:
    HMPREF0772_11820 (pstC)
    TW20:
    SATW20_13870
    USA300_TCH1516:
    USA300HOU_1322 (pstC)
    VC40:
    SAVC_06185

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTSSTNVKALIEKNNNKKGKHNDKIIPVILAAISAISILTTLGILITLLLETITFFTRIP
    N315            MTSSTNVKALIEKNINKKGKHNDKIIPVILAAISAISILTTLGILITLLLETITFFTRIP
    NCTC8325        MTSSTNVKALIEKNNNKKGKHNDKIIPVILAAISAISILTTLGILITLLLETITFFTRIP
    Newman          MTSSTNVKALIEKNNNKKGKHNDKIIPVILAAISAISILTTLGILITLLLETITFFTRIP
    USA300_FPR3757  MTSSTNVKALIEKNNNKKGKHNDKIIPVILAAISAISILTTLGILITLLLETITFFTRIP
                    ************** *********************************************

    COL             ITEFLFSTTWNPTGSDPKFGIWALIIGTLKITVIATIFAVPVGLGAAIYLSEYASDRARR
    N315            ITEFLFSTTWNPTGSDPKFGIWALIIGTLKITVIATIFAVPVGLGAAIYLSEYASDRARR
    NCTC8325        ITEFLFSTTWNPTGSDPKFGIWALIIGTLKITVIATIFAVPVGLGAAIYLSEYASDRARR
    Newman          ITEFLFSTTWNPTGSDPKFGIWALIIGTLKITVIATIFAVPVGLGAAIYLSEYASDRARR
    USA300_FPR3757  ITEFLFSTTWNPTGSDPKFGIWALIIGTLKITVIATIFAVPVGLGAAIYLSEYASDRARR
                    ************************************************************

    COL             IIKPILEILAGIPTIVFGFFALTFVTPVLRSFIPGLGEFNAISPGLVVGIMIVPLITSLS
    N315            IIKPILEILAGIPTIVFGFFALTFVTPVLRSFISGLGEFNAISPGLVVGIMIVPLITSLS
    NCTC8325        IIKPILEILAGIPTIVFGFFALTFVTPVLRSFIPGLGEFNAISPGLVVGIMIVPLITSLS
    Newman          IIKPILEILAGIPTIVFGFFALTFVTPVLRSFIPGLGEFNAISPGLVVGIMIVPLITSLS
    USA300_FPR3757  IIKPILEILAGIPTIVFGFFALTFVTPVLRSFIPGLGEFNAISPGLVVGIMIVPLITSLS
                    *********************************.**************************

    COL             EDAMASVPNKIREGAYGLGATKLEVATKVVLPAATSGIVASIVLAISRAIGETMIVSLAA
    N315            EDAMASVPNKIREGAYGLGATKLEVATKVVLPAATSGIVASIVLAISRAIGETMIVSLAA
    NCTC8325        EDAMASVPNKIREGAYGLGATKLEVATKVVLPAATSGIVASIVLAISRAIGETMIVSLAA
    Newman          EDAMASVPNKIREGAYGLGATKLEVATKVVLPAATSGIVASIVLAISRAIGETMIVSLAA
    USA300_FPR3757  EDAMASVPNKIREGAYGLGATKLEVATKVVLPAATSGIVASIVLAISRAIGETMIVSLAA
                    ************************************************************

    COL             GSSPTASLSLTSSIQTMTGYIVEIATGDATFGSNIYYSIYAVGFTLFIFTLIMNLLSQWI
    N315            GSSPTASLSLTSSIQTMTGYIVEIATGDATFGSNIYYSIYAVGFTLFIFTLIMNLLSQWI
    NCTC8325        GSSPTASLSLTSSIQTMTGYIVEIATGDATFGSNIYYSIYAVGFTLFIFTLIMNLLSQWI
    Newman          GSSPTASLSLTSSIQTMTGYIVEIATGDATFGSNIYYSIYAVGFTLFIFTLIMNLLSQWI
    USA300_FPR3757  GSSPTASLSLTSSIQTMTGYIVEIATGDATFGSNIYYSIYAVGFTLFIFTLIMNLLSQWI
                    ************************************************************

    COL             SKRFREEY
    N315            SKRFREEY
    NCTC8325        SKRFREEY
    Newman          SKRFREEY
    USA300_FPR3757  SKRFREEY
                    ********