From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003806000
  • symbol?: lysC
  • description?: aspartate kinase

      descriptions from strain specific annotations:

    • aspartate kinase
    • Aspartokinase
    • aspartokinase II
    • aspartokinase 2 (Aspartokinase II) (Aspartate kinase 2)
    • aspartokinase, alpha and beta subunits
    • aspartate kinase domain protein
    • aspartate kinase II
  • strand?: +
  • coordinates?: 4097180..4098385
  • synteny block?: BlockID0028630
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1428 (lysC)
    N315:
    SA1225 (lysC)
    NCTC8325:
    Newman:
    NWMN_1304 (lysC)
    USA300_FPR3757:
    04-02981:
    SA2981_1347 (lysC)
    08BA02176:
    C248_1432 (lysC)
    11819-97:
    MS7_1349
    71193:
    ST398NM01_1394
    ECT-R 2:
    ECTR2_1250
    ED133:
    SAOV_1402 (lysC)
    ED98:
    SAAV_1376 (lysC)
    HO 5096 0412:
    SAEMRSA15_12560 (lysC)
    JH1:
    SaurJH1_1483
    JH9:
    SaurJH9_1454
    JKD6008:
    SAA6008_01357 (lysC)
    JKD6159:
    SAA6159_01259 (lysC)
    LGA251:
    SARLGA251_13090 (lysC)
    M013:
    M013TW_1337
    MRSA252:
    SAR1405 (lysC)
    MSHR1132:
    SAMSHR1132_12340
    MSSA476:
    SAS1334
    Mu3:
    SAHV_1381 (lysC)
    Mu50:
    SAV1393 (lysC)
    MW2:
    MW1281 (lysC)
    RF122:
    SAB1248 (lysC)
    ST398:
    SAPIG1394
    T0131:
    SAT0131_01467 (bioD)
    TCH60:
    HMPREF0772_11816 (lysC)
    TW20:
    SATW20_13920 (lysC)
    USA300_TCH1516:
    USA300HOU_1328 (lysC2)
    VC40:
    SAVC_06210

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVTRSVLKFGGSSVSDFTKLKRIAEMLKERVNQDEQLIVVVSAMGNTTDQLMTNVSTLTK
    N315            MVTRSVLKFGGSSVSDFTKIKRIAEMLKERVNQDEQLIVVVSAMGNTTDQLMTNVSTLTK
    NCTC8325        MVTRSVLKFGGSSVSDFTKIKRIAEMLKERVNQDEQLIVVVSAMGNTTDQLMTNVSTLTK
    Newman          MVTRSVLKFGGSSVSDFTKIKRIAEMLKERVNQDEQLIVVVSAMGNTTDQLMTNVSTLTK
    USA300_FPR3757  MVTRSVLKFGGSSVSDFTKIKRIAEMLKERVNQDEQLIVVVSAMGNTTDQLMTNVSTLTK
                    *******************:****************************************

    COL             APKQQELALLLTTGEQQTVSYLSMVLNDIGMNAKAMTGYQAGIKTIGHHLKSKIAQINPQ
    N315            APKQQELALLLTTGEQQTVSYLSMVLNDIGVNAKAMTGYQAGIKTIGHHLKSKIAQINPQ
    NCTC8325        APKQQELALLLTTGEQQTVSYLSMVLNDIGMNAKAMTGYQAGIKTIGHHLKSKIAQINPQ
    Newman          APKQQELALLLTTGEQQTVSYLSMVLNDIGMNAKAMTGYQAGIKTIGHHLKSKIAQINPQ
    USA300_FPR3757  APKQQELALLLTTGEQQTVSYLSMVLNDIGMNAKAMTGYQAGIKTIGHHLKSKIAQINPQ
                    ******************************:*****************************

    COL             TFEQAFQENDILVVAGFQGINEHQELTTLGRGGSDTTAVALAVSNQIPCEIYTDVDGVYA
    N315            TFEQAFQENDILVVAGFQGINEHQELTTLGRGGSDTTAVALAVSNQIPCEIYTDVDGVYA
    NCTC8325        TFEQAFQENDILVVAGFQGINEHQELTTLGRGGSDTTAVALAVSNQIPCEIYTDVDGVYA
    Newman          TFEQAFQENDILVVAGFQGINEHQELTTLGRGGSDTTAVALAVSNQIPCEIYTDVDGVYA
    USA300_FPR3757  TFEQAFQENDILVVAGFQGINEHQELTTLGRGGSDTTAVALAVSNQIPCEIYTDVDGVYA
                    ************************************************************

    COL             TDPRLLPKAKRLDIVSYEEMMEMSALGAGVLETRSVELAKNYNIPLYLGKTLSNVKGTWI
    N315            TDPRLLPKAKRLDIVSYEEMMEMSALGAGVLETRSVELAKNYNIPLYLGKTLSNVKGTWI
    NCTC8325        TDPRLLPKAKRLDIVSYEEMMEMSALGAGVLETRSVELAKNYNIPLYLGKTLSNVKGTWI
    Newman          TDPRLLPKAKRLDIVSYEEMMEMSALGAGVLETRSVELAKNYNIPLYLGKTLSNVKGTWI
    USA300_FPR3757  TDPRLLPKAKRLDIVSYEEMMEMSALGAGVLETRSVELAKNYNIPLYLGKTLSNVKGTWI
                    ************************************************************

    COL             MSNEEILEKKAVTGVALDKHMMHVTISYPLPDNQLLTQLFTELEEGAVNVDMISQIVNLD
    N315            MSNEEILEKKAVTGVALDKHMMHVTISYPLPDNQLLTQLFTELEEGAVNVDMISQIVNLD
    NCTC8325        MSNEEILEKKAVTGVALDKHMMHVTISYPLPDNQLLTQLFTELEEGAVNVDMISQIVNLD
    Newman          MSNEEILEKKAVTGVALDKHMMHVTISYPLPDNQLLTQLFTELEEGAVNVDMISQIVNLD
    USA300_FPR3757  ISNEEILEKKAVTGVALDKHMMHVTISYPLPDNQLLTQLFTELEEGAVNVDMISQIVNLD
                    :***********************************************************

    COL             GLQLSFTIKDSDFHQISMILETLKNQYEALAYKINEHYVKISLIGSGMRDMSGVASKAFL
    N315            GLQLSFTIKDSDFHQISMILETLKNQYEALAYKINEHYVKISLIGSGMRDMSGVASKAFL
    NCTC8325        GLQLSFTIKDSDFHQISMILETLKNQYEALAYKINEHYVKISLIGSGMRDMSGVASKAFL
    Newman          GLQLSFTIKDSDFHQISMILETLKNQYEALAYKINEHYVKISLIGSGMRDMSGVASKAFL
    USA300_FPR3757  GLQLSFTIKDSDFHQISMILETLKNQYEALAYKINEHYVKISLIGSGMRDMSGVASKAFL
                    ************************************************************

    COL             TLIENNIPFYQTTTSEISISYVIDDFNGQQAVEKLYDAFNI
    N315            TLIENNIPFYQTTTSEISISYVIDDFNGQQAVEKLYDAFNI
    NCTC8325        TLIENNIPFYQTTTSEISISYVIDDFNGQQAVEKLYDAFNI
    Newman          TLIENNIPFYQTTTSEISISYVIDDFNGQQAVEKLYDAFNI
    USA300_FPR3757  TLIENNIPFYQTTTSEISISYVIDDFNGQQAVEKLYDAFNI
                    *****************************************