From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003819000
  • symbol?:
  • description?: DNA binding protein
  • strand?: -
  • coordinates?: 4108969..4109277
  • synteny block?: BlockID0028760
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1357
    08BA02176:
    C248_1443
    11819-97:
    MS7_1359
    71193:
    ST398NM01_1405
    ECT-R 2:
    ECTR2_1260
    ED133:
    SAOV_1413c
    ED98:
    SAAV_1387
    HO 5096 0412:
    SAEMRSA15_12660
    JH1:
    SaurJH1_1493
    JH9:
    SaurJH9_1464
    JKD6008:
    SAA6008_01367
    JKD6159:
    SAA6159_01270
    LGA251:
    SARLGA251_13200
    M013:
    M013TW_1348
    MRSA252:
    SAR1415
    MSHR1132:
    SAMSHR1132_12440
    MSSA476:
    SAS1344
    Mu3:
    SAHV_1391
    Mu50:
    SAV1403
    MW2:
    MW1291
    RF122:
    SAB1259c
    ST398:
    SAPIG1405
    T0131:
    SAT0131_01478
    TCH60:
    HMPREF0772_11806
    TW20:
    SATW20_14020
    USA300_TCH1516:
    VC40:
    SAVC_06260

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MWTVTKIRADYEGWWLFSDWPENIVEKYQYQDFDDMFKHYQQLINQCKVQFDNYVTGKYN
    N315            MWTVTKIRADYEGWWLFSDWPENIVEKYQYQDFDDMFKHYQQLINQCKVQFDNYVTGKYN
    NCTC8325        MWTVTKIRADYEGWWLFSDWPENIVEKYQYQDFDDMFKHYQQLINQCKVQFDNYVTGKYN
    Newman          MWTVTKIRADYEGWWLFSDWPENIVEKYQYQDFDDMFKHYQQLINQCKVQFDNYVTGKYN
    USA300_FPR3757  MWTVTKIRADYEGWWLFSDWPENIVEKYQYQDFDDMFKHYQQLINQCKVQFDNYVTGKYN
                    ************************************************************

    COL             IYAFYNNCDMNYCEDCEEDLQIFYSFIVLQNNEVYYKLPIID
    N315            IYAFYNNCDMNYCEDCEEDLQIFYSFIVLQNNEVYYKLPIID
    NCTC8325        IYAFYNNCDMNYCEDCEEDLQIFYSFIVLQNNEVYYKLPIID
    Newman          IYAFYNNCDMNYCEDCEEDLQIFYSFIVLQNNEVYYKLPIID
    USA300_FPR3757  IYAFYNNCDMNYCEDCEEDLQIFYSFIVLQNNEVYYKLPIID
                    ******************************************