From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003827000
  • symbol?:
  • description?: CbbQ/NirQ/NorQ/GpvN family protein

      descriptions from strain specific annotations:

    • CbbQ/NirQ/NorQ/GpvN family protein
    • ATPase family protein
    • AAA ATPase
    • ATPase
    • ATPase family associated with various cellular activities (AAA) family protein
    • ATPase family associated with various cellular activities protein
    • nitric-oxide reductase
    • Nitric oxide reductase activation protein NorQ
    • nitric oxide reductase protein
  • strand?: -
  • coordinates?: 4116536..4117327
  • synteny block?: BlockID0028840
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1363 (norQ)
    08BA02176:
    C248_1448
    11819-97:
    MS7_1365
    71193:
    ST398NM01_1411
    ECT-R 2:
    ECTR2_1266
    ED133:
    SAOV_1419c
    ED98:
    SAAV_1393
    HO 5096 0412:
    SAEMRSA15_12720
    JH1:
    SaurJH1_1499
    JH9:
    SaurJH9_1470
    JKD6008:
    SAA6008_01375
    JKD6159:
    SAA6159_01276
    LGA251:
    SARLGA251_13260
    M013:
    M013TW_1354
    MRSA252:
    SAR1421
    MSHR1132:
    SAMSHR1132_12500
    MSSA476:
    SAS1352
    Mu3:
    SAHV_1397
    Mu50:
    SAV1409
    MW2:
    MW1299
    RF122:
    SAB1265c
    ST398:
    SAPIG1411
    T0131:
    SAT0131_01487
    TCH60:
    HMPREF0772_11800
    TW20:
    SATW20_14100
    USA300_TCH1516:
    USA300HOU_1344
    VC40:
    SAVC_06295

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MALKHYKNSDSTVFNDAKALFDLNKNILLKGPTGSGKTKLAETLSEVVDTPMHQVNCSVD
    N315            MALKHYKNSDSTVFNDAKALFDLNKNILLKGPTGSGKTKLAETLSEVVDTPMHQVNCSVD
    NCTC8325        MALKHYKNSDSTVFNDAKALFDLNKNILLKGPTGSGKTKLAETLSEVVDTPMHQVNCSVD
    Newman          MALKHYKNSDSTVFNDAKALFDLNKNILLKGPTGSGKTKLAETLSEVVDTPMHQVNCSVD
    USA300_FPR3757  MALKHYKNSDSTVFNDAKALFDLNKNILLKGPTGSGKTKLAETLSEVVDTPMHQVNCSVD
                    ************************************************************

    COL             LDTESLLGFKTIKTNAEGQQEIVFVDGPVIKAMKEGHILYIDEINMAKPETLPVLNGVLD
    N315            LDTESLLGFKTIKTNAEGQQEIVFVDGPVIKAMKEGHILYIDEINMAKPETLPVLNGVLD
    NCTC8325        LDTESLLGFKTIKTNAEGQQEIVFVDGPVIKAMKEGHILYIDEINMAKPETLPVLNGVLD
    Newman          LDTESLLGFKTIKTNAEGQQEIVFVDGPVIKAMKEGHILYIDEINMAKPETLPVLNGVLD
    USA300_FPR3757  LDTESLLGFKTIKTNAEGQQEIVFVDGPVIKAMKEGHILYIDEINMAKPETLPVLNGVLD
                    ************************************************************

    COL             YRRQITNPYTGEVIKAVPGFNVIAAINEGYVGTLPMNEALKNRFVVIHVDYIDGDILKNV
    N315            YRRQITNPYTGEVIKAVPGFNVIAAINEGYVGTLPMNEALKNRFVVIHVDYIDGDILKNV
    NCTC8325        YRRQITNPYTGEVIKAVPGFNVIAAINEGYVGTLPMNEALKNRFVVIHVDYIDGDILKNV
    Newman          YRRQITNPYTGEVIKAVPGFNVIAAINEGYVGTLPMNEALKNRFVVIHVDYIDGDILKNV
    USA300_FPR3757  YRRQITNPYTGEVIKAVPGFNVIAAINEGYVGTLPMNEALKNRFVVIHVDYIDGDILKNV
                    ************************************************************

    COL             IKEQSLLQDDKQIEQIIKFNEDLRTMSKQGQISEEAASIRALLDLCDLITVMPVERAIKR
    N315            IKEQSLLQDDKQIEQIIKFNEDLRTMSKQGQISEEAASIRALLDLCDLITVMPVERAIKR
    NCTC8325        IKEQSLLQDDKQIEQIIKFNEDLRTMSKQGQISEEAASIRALLDLCDLITVMPVERAIKR
    Newman          IKEQSLLQDDKQIEQIIKFNEDLRTMSKQGQISEEAASIRALLDLCDLITVMPVERAIKR
    USA300_FPR3757  IKEQSLLQGDKQIEQIIKFNEDLRTMSKQGQISEEAASIRALLDLCDLITVMPVERAIKR
                    ********.***************************************************

    COL             TIIDKLEDEREQQAIYNAVELNF
    N315            TIIDKLEDEREQQAIYNAVELNF
    NCTC8325        TIIDKLEDEREQQAIYNAVELNF
    Newman          TIIDKLEDEREQQAIYNAVELNF
    USA300_FPR3757  TIIDKLEDEREQQAIYNAVELNF
                    ***********************