From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003842000
  • symbol?:
  • description?: type 2 phosphatidic acid phosphatase family protein

      descriptions from strain specific annotations:

    • type 2 phosphatidic acid phosphatase family protein
    • PAP2 superfamily protein
    • lipid phosphate phosphohydrolase 2 family protein
    • membrane-associated phospholipid phosphatase
    • membrane protein
    • phosphoesterase, PA-phosphatase-like protein
    • Phosphatase
  • strand?: -
  • coordinates?: 4129451..4130065
  • synteny block?: BlockID0028990
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1371
    08BA02176:
    C248_1457
    11819-97:
    MS7_1372
    71193:
    ST398NM01_1418
    ECT-R 2:
    ECTR2_1273
    ED133:
    SAOV_1426c
    ED98:
    SAAV_1400
    HO 5096 0412:
    SAEMRSA15_12800
    JH1:
    SaurJH1_1506
    JH9:
    SaurJH9_1477
    JKD6008:
    SAA6008_01385
    JKD6159:
    SAA6159_01284
    LGA251:
    SARLGA251_13330
    M013:
    M013TW_1363
    MRSA252:
    SAR1429
    MSHR1132:
    SAMSHR1132_12570
    MSSA476:
    SAS1359
    Mu3:
    SAHV_1405
    Mu50:
    SAV1417
    MW2:
    MW1306
    RF122:
    SAB1272c
    ST398:
    SAPIG1418
    T0131:
    SAT0131_01497 (ahpF)
    TCH60:
    HMPREF0772_11790
    TW20:
    SATW20_14180
    USA300_TCH1516:
    USA300HOU_1354
    VC40:
    SAVC_06335

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSQWKRISLLIVFTLVFGIIAFFHESRLGKWIDNEVYEFVYSSESFITTSIMLGATKVGE
    N315            MSQWKRISLLIVFALVFGIIAFFHESRLGKWIDNEVYEFIYSSESFITTSIMLGATKVGE
    NCTC8325        MSQWKRISLLIVFTLVFGIIAFFHESRLGKWIDNEVYEFVYSSESFITTSIMLGATKVGE
    Newman          MSQWKRISLLIVFTLVFGIIAFFHESRLGKWIDNEVYEFVYSSESFITTSIMLGATKVGE
    USA300_FPR3757  MSQWKRISLLIVFTLVFGIIAFFHESRLGKWIDNEVYEFVYSSESFITTSIMLGATKVGE
                    *************:*************************:********************

    COL             VWAMLCISLLLVAYLMLKRHKIEALFFALTMALSGILNPALKNIFDRERPTLLRLIDITG
    N315            VWAMLCISLLLVAYLMLKRHKIEALFFALTMALSGILNPALKNIFDRERPTLLRLIDITG
    NCTC8325        VWAMLCISLLLVAYLMLKRHKIEALFFALTMALSGILNPALKNIFDRERPTLLRLIDITG
    Newman          VWAMLCISLLLVAYLMLKRHKIEALFFALTMALSGILNPALKNIFDRERPTLLRLIDITG
    USA300_FPR3757  VWAMLCISLLLVAYLMLKRHKIEALFFALTMALSGILNPALKNIFDRERPTLLRLIDITG
                    ************************************************************

    COL             FSFPSGHAMGSTAYFGSGIYLLNRLNQGNSKGILIGLCAAMILLISISRVYLGVHYPTDI
    N315            FSFPSGHAMGSTAYFGSGIYLLNRLNQGNSKGILIGLCAAMILLISISRVYLGVHYPTDI
    NCTC8325        FSFPSGHAMGSTAYFGSGIYLLNRLNQGNSKGILIGLCAAMILLISISRVYLGVHYPTDI
    Newman          FSFPSGHAMGSTAYFGSGIYLLNRLNQGNSKGILIGLCAAMILLISISRVYLGVHYPTDI
    USA300_FPR3757  FSFPSGHAMGSTAYFGSGIYLLNRLNQGNSKGILIGLCAAMILLISISRVYLGVHYPTDI
                    ************************************************************

    COL             IAGIIGGLFCIILSTLLLRNKLIN
    N315            IAGIIGGVFCIILSTLLLRNKLIN
    NCTC8325        IAGIIGGLFCIILSTLLLRNKLIN
    Newman          IAGIIGGLFCIILSTLLLRNKLIN
    USA300_FPR3757  IAGIIGGLFCIILSTLLLRNKLIN
                    *******:****************