From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1329 [new locus tag: NWMN_RS07485 ]
  • pan locus tag?: SAUPAN003842000
  • symbol: NWMN_1329
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1329 [new locus tag: NWMN_RS07485 ]
  • symbol: NWMN_1329
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1463035..1463649
  • length: 615
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAGTCAATGGAAACGTATCTCTTTGCTCATCGTTTTTACATTGGTTTTTGGAATTATC
    GCGTTTTTCCACGAATCAAGACTTGGGAAATGGATTGATAATGAAGTTTATGAGTTTGTA
    TATTCATCAGAGAGCTTTATTACGACATCTATCATGCTTGGGGCTACTAAAGTAGGTGAA
    GTCTGGGCAATGTTATGTATTTCATTACTTCTTGTGGCATATCTCATGTTAAAGCGCCAC
    AAAATTGAAGCATTATTTTTTGCATTAACAATGGCATTATCTGGAATTTTGAATCCAGCA
    TTAAAAAATATATTCGATAGAGAAAGACCTACATTGCTGCGTTTAATTGATATAACAGGA
    TTTAGTTTTCCTAGCGGTCATGCTATGGGATCAACTGCATATTTTGGAAGTGGTATCTAT
    CTATTAAATCGATTAAATCAAGGTAATTCAAAAGGTATTCTTATAGGGTTATGTGCAGCT
    ATGATTTTATTGATTTCCATATCACGTGTATATCTAGGTGTACATTATCCAACAGATATT
    ATTGCCGGCATTATTGGTGGATTATTTTGCATTATTTTATCAACGTTATTACTTAGAAAT
    AAATTAATAAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    615

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1329 [new locus tag: NWMN_RS07485 ]
  • symbol: NWMN_1329
  • description: hypothetical protein
  • length: 204
  • theoretical pI: 9.63103
  • theoretical MW: 22715.1
  • GRAVY: 0.770588

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein fateProtein and peptide secretion and traffickingsignal peptidase II (TIGR00077; EC 3.4.23.36; HMM-score: 14.8)
    Cell structureCell envelopeOtherTIGR01666 family membrane protein (TIGR01666; HMM-score: 9.2)
  • TheSEED:  
    type 2 phosphatidic acid phosphatase family protein 
  • PFAM:
    pap2 (CL0525) PAP2; PAP2 superfamily (PF01569; HMM-score: 76.3)
    PAP2_3; PAP2 superfamily (PF14378; HMM-score: 34.9)
    PAP2_C; PAP2 superfamily C-terminal (PF14360; HMM-score: 8.1)
    no clan definedTmemb_170; Putative transmembrane protein 170 (PF10190; HMM-score: 7.7)
    Peptidase_A8; Signal peptidase (SPase) II (PF01252; HMM-score: 6.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 6
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.188
    • Ymax_pos: 11
    • Cmax: 0.132
    • Cmax_pos: 30
    • Smax: 0.483
    • Smax_pos: 1
    • Smean: 0.316
    • D: 0.238
  • predicted transmembrane helices (TMHMM): 6

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSQWKRISLLIVFTLVFGIIAFFHESRLGKWIDNEVYEFVYSSESFITTSIMLGATKVGEVWAMLCISLLLVAYLMLKRHKIEALFFALTMALSGILNPALKNIFDRERPTLLRLIDITGFSFPSGHAMGSTAYFGSGIYLLNRLNQGNSKGILIGLCAAMILLISISRVYLGVHYPTDIIAGIIGGLFCIILSTLLLRNKLIN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]