From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003853000
  • symbol?: crr
  • description?: glucose-specific phosphotransferase enzyme IIA component

      descriptions from strain specific annotations:

    • glucose-specific phosphotransferase enzyme IIA component
    • PTS system, IIA component
    • PTS system glucose-specific transporter subunit enzyme II A
    • PTS system transporter subunit IIA
    • phosphotransferase system glucose-specific IIA component
    • PTS system, glucose-specific IIA component
    • glucose-specific enzyme II, PTS system A component
    • phosphotransferase system enzyme IIA
    • PTS family glucose/glucoside (glc) porter component IIA
    • pts system glucose-specific eiicba component (eiicba-glc) (eii-glc/eiii-glc)
    • PTS system glucose-specific enzyme II A component
    • PTS system glucose-specific transporter subunit IIA
    • PTS system glucose-specific transporter subunit IICBA
    • PTS system glucose subfamily transporter subunit IIA
  • strand?: -
  • coordinates?: 4137271..4137771
  • synteny block?: BlockID0029090
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1376
    08BA02176:
    C248_1462
    11819-97:
    MS7_1378 (crr)
    71193:
    ST398NM01_1423
    ECT-R 2:
    ECTR2_1278 (ptbA)
    ED133:
    SAOV_1431c
    ED98:
    SAAV_1405
    HO 5096 0412:
    SAEMRSA15_12850
    JH1:
    SaurJH1_1511
    JH9:
    SaurJH9_1482
    JKD6008:
    SAA6008_01390 (crr)
    JKD6159:
    SAA6159_01289 (crr)
    LGA251:
    SARLGA251_13380
    M013:
    M013TW_1368
    MRSA252:
    SAR1435
    MSHR1132:
    SAMSHR1132_12640
    MSSA476:
    SAS1365
    Mu3:
    SAHV_1410
    Mu50:
    SAV1422
    MW2:
    MW1312
    RF122:
    SAB1277c
    ST398:
    SAPIG1423
    T0131:
    SAT0131_01502
    TCH60:
    HMPREF0772_11784 (ptsG3)
    TW20:
    SATW20_14230
    USA300_TCH1516:
    USA300HOU_1359
    VC40:
    SAVC_06360

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFKKLFGKGKEVQKDIAIYAPLTGEFVKIEDIPDPVFAQKMMGEGFGINPTEGEVVSPIA
    N315            MFKKLFGKGKEVQKDIAIYAPLTGEYVKIEDIPDPVFAQKMMGEGFGINPTEGEVVSPIA
    NCTC8325        MFKKLFGKGKEVQKDIAIYAPLTGEFVKIEDIPDPVFAQKMMGEGFGINPTEGEVVSPIA
    Newman          MFKKLFGKGKEVQKDIAIYAPLTGEFVKIEDIPDPVFAQKMMGEGFGINPTEGEVVSPIA
    USA300_FPR3757  MFKKLFGKGKEVQKDIAIYAPLTGEFVKIEDIPDPVFAQKMMGEGFGINPTEGEVVSPIA
                    *************************:**********************************

    COL             GRVDNVFPTKHAIGLKADNGLELLVHIGLDTVQLDGEGFEVLVSSGDEVNVGDPLVRFNL
    N315            GRVDNVFPTKHAIGLKADNGLELLVHIGLDTVQLDGEGFEVLVSSGDEVNVGDPLVRFNL
    NCTC8325        GRVDNVFPTKHAIGLKADNGLELLVHIGLDTVQLDGEGFEVLVSSGDEVNVGDPLVRFNL
    Newman          GRVDNVFPTKHAIGLKADNGLELLVHIGLDTVQLDGEGFEVLVSSGDEVNVGDPLVRFNL
    USA300_FPR3757  GRVDNVFPTKHAIGLKADNGLELLVHIGLDTVQLDGEGFEVLVSSGDEVNVGDPLVRFNL
                    ************************************************************

    COL             EYINNNAKSVISPIIITNTDQAASINIYDENAVIKGETKVIDVTMN
    N315            EFINNNAKSVISPIIITNTDQAASINIYDENAVIKGETKVIDVTMN
    NCTC8325        EYINNNAKSVISPIIITNTDQAASINIYDENAVIKGETKVIDVTMN
    Newman          EYINNNAKSVISPIIITNTDQAASINIYDENAVIKGETKVIDVTMN
    USA300_FPR3757  EYINNNAKSVISPIIITNTDQAASINIYDENAVIKGETKVIDVTMN
                    *:********************************************