From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1255 [new locus tag: SA_RS07120 ]
  • pan locus tag?: SAUPAN003853000
  • symbol: SA1255
  • pan gene symbol?: crr
  • synonym:
  • product: PTS system glucose-specific transporter subunit enzyme II A

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1255 [new locus tag: SA_RS07120 ]
  • symbol: SA1255
  • product: PTS system glucose-specific transporter subunit enzyme II A
  • replicon: chromosome
  • strand: -
  • coordinates: 1429500..1430000
  • length: 501
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGTTTAAAAAATTATTCGGAAAAGGCAAAGAAGTTCAGAAAGATATCGCAATTTATGCA
    CCATTAACTGGAGAATACGTGAAAATTGAAGATATTCCAGATCCTGTATTCGCACAAAAA
    ATGATGGGCGAAGGTTTTGGTATTAATCCAACTGAAGGAGAAGTTGTGTCTCCAATTGCA
    GGACGTGTTGACAATGTCTTTCCAACTAAGCATGCGATTGGGTTAAAAGCAGATAACGGA
    TTAGAATTATTAGTTCATATCGGTTTAGACACAGTTCAATTAGACGGTGAAGGATTTGAA
    GTGTTAGTGTCTAGTGGTGACGAAGTTAACGTCGGAGATCCATTAGTAAGATTCAACCTT
    GAATTTATTAATAATAACGCTAAATCTGTTATTTCACCAATTATAATTACTAACACTGAT
    CAAGCAGCTTCAATTAATATTTATGATGAAAATGCTGTGATTAAAGGTGAAACAAAAGTG
    ATTGATGTGACAATGAACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    501

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1255 [new locus tag: SA_RS07120 ]
  • symbol: SA1255
  • description: PTS system glucose-specific transporter subunit enzyme II A
  • length: 166
  • theoretical pI: 4.26969
  • theoretical MW: 17960.4
  • GRAVY: 0.0162651

Function[edit source | edit]

  • reaction:
    EC 2.7.1.-?  ExPASy
    Protein EIIA N(pi)-phospho-L-histidine + protein EIIB = protein EIIA + protein EIIB N(pi)-phospho-L-histidine/cysteine?
  • TIGRFAM:
    PTS system, beta-glucoside-specific IIABC component (TIGR01995; EC 2.7.1.69; HMM-score: 181.2)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsPTS system, glucose subfamily, IIA component (TIGR00830; HMM-score: 151.8)
    Signal transductionSignal transductionPTSPTS system, glucose subfamily, IIA component (TIGR00830; HMM-score: 151.8)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion membrane fusion protein, HlyD family (TIGR01843; HMM-score: 11.6)
  • TheSEED:  
    CarbohydratesDi- and oligosaccharidesTrehalose Uptake and Utilization PTS system, glucose-specific IIA component 
  • PFAM:
    Hybrid (CL0105) PTS_EIIA_1; phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1 (PF00358; HMM-score: 177.2)
    RnfC_N; RnfC Barrel sandwich hybrid domain (PF13375; HMM-score: 18.7)
    Biotin_lipoyl; Biotin-requiring enzyme (PF00364; HMM-score: 13.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.11
    • Ymax_pos: 11
    • Cmax: 0.149
    • Cmax_pos: 39
    • Smax: 0.147
    • Smax_pos: 2
    • Smean: 0.115
    • D: 0.112
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MFKKLFGKGKEVQKDIAIYAPLTGEYVKIEDIPDPVFAQKMMGEGFGINPTEGEVVSPIAGRVDNVFPTKHAIGLKADNGLELLVHIGLDTVQLDGEGFEVLVSSGDEVNVGDPLVRFNLEFINNNAKSVISPIIITNTDQAASINIYDENAVIKGETKVIDVTMN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Alexander Scherl, Patrice François, Manuela Bento, Jacques M Deshusses, Yvan Charbonnier, Véronique Converset, Antoine Huyghe, Nadia Walter, Christine Hoogland, Ron D Appel, Jean-Charles Sanchez, Catherine G Zimmermann-Ivol, Garry L Corthals, Denis F Hochstrasser, Jacques Schrenzel
Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.
J. Microbiol. Methods: 2005, 60(2);247-57
[PubMed:15590099] [WorldCat.org] [DOI] (P p)