From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003894000
  • symbol?:
  • description?: 5'-3' exonuclease

      descriptions from strain specific annotations:

    • 5'-3' exonuclease
    • putative 5'-3' exonuclease
    • 5'-3' exonuclease, C-terminal SAM fold family protein
    • 5'-3' exonuclease, putative
    • DNA polymerase I
    • probable 5'-3' exonuclease
  • strand?: -
  • coordinates?: 4215889..4216767
  • synteny block?: BlockID0029400
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1395
    08BA02176:
    C248_1479
    11819-97:
    MS7_1396 (ypcP)
    71193:
    ST398NM01_1439
    ECT-R 2:
    ECTR2_1294
    ED133:
    SAOV_1449
    ED98:
    SAAV_1424
    HO 5096 0412:
    SAEMRSA15_13020
    JH1:
    SaurJH1_1529
    JH9:
    SaurJH9_1500
    JKD6008:
    SAA6008_01408
    JKD6159:
    SAA6159_01305
    LGA251:
    SARLGA251_13550
    M013:
    M013TW_1387
    MRSA252:
    SAR1452
    MSHR1132:
    SAMSHR1132_12810
    MSSA476:
    SAS1383
    Mu3:
    SAHV_1428
    Mu50:
    SAV1440
    MW2:
    MW1329
    RF122:
    SAB1305c
    ST398:
    SAPIG1439
    T0131:
    SAT0131_01528
    TCH60:
    HMPREF0772_11766
    TW20:
    SATW20_14400
    USA300_TCH1516:
    USA300HOU_1377
    VC40:
    SAVC_06455

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MPNKILLVDGMALLFRHFYATSLHKQFMYNSQGEPTNGIQGFVRHIFSAIHEIRPTHVAV
    N315            MPNKILLVDGMALLFRHFYATSLHKQFMYNSQGVPTNGIQGFVRHIFSAIHEIRPTHVAV
    NCTC8325        MPNKILLVDGMALLFRHFYATSLHKQFMYNSQGEPTNGIQGFVRHIFSAIHEIRPTHVAV
    Newman          MPNKILLVDGMALLFRHFYATSLHKQFMYNSQGEPTNGIQGFVRHIFSAIHEIRPTHVAV
    USA300_FPR3757  MPNKILLVDGMALLFRHFYATSLHKQFMYNSQGEPTNGIQGFVRHIFSAIHEIRPTHVAV
                    ********************************* **************************

    COL             CWDMGQSTFRNDMFDGYKQNRSAPPEELIPQFDYVKEISEQFGFVNIGVKNYEADDVIGT
    N315            CWDMGQSTFRNDMFDGYKQNRSAPPEELIPQFDYVKEISEQFGFVNIGVKNYEADDVIGT
    NCTC8325        CWDMGQSTFRNDMFDGYKQNRSAPPEELIPQFDYVKEISEQFGFVNIGVKNYEADDVIGT
    Newman          CWDMGQSTFRNDMFDGYKQNRSAPPEELIPQFDYVKEISEQFGFVNIGVKNYEADDVIGT
    USA300_FPR3757  CWDMGQSTFRNDMFDGYKQNRSAPPEELIPQFDYVKEISEQFGFVNIGVKNYEADDVIGT
                    ************************************************************

    COL             LAQQYSTDNDVYIITGDKDLLQCINDNVEVWLIKKGFNIYNRYTLHRFNEEYALEPQQLI
    N315            LAQQYSTDNDVYIITGDKDLLQCINDNVEVWLIKKGFNIYNRYTLHRFNEEYALEPQQLI
    NCTC8325        LAQQYSTDNDVYIITGDKDLLQCINDNVEVWLIKKGFNIYNRYTLHRFNEEYALEPQQLI
    Newman          LAQQYSTDNDVYIITGDKDLLQCINDNVEVWLIKKGFNIYNRYTLHRFNEEYALEPQQLI
    USA300_FPR3757  LAQQYSTDNDVYIITGDKDLLQCINDNVEVWLIKKGFNIYNRYTLHRFNEEYALEPQQLI
                    ************************************************************

    COL             DIKAFMGDTADGYAGVKGIGEKTAIKLIQQYQSVENVVENIDALSAGQRNKINDNLDELY
    N315            DIKAFMGDTADGYAGVKGIGEKTAIKLIQQYQSVENVVENIDALSAGQRNKINDNLDELY
    NCTC8325        DIKAFMGDTADGYAGVKGIGEKTAIKLIQQYQSVENVVENIDALSAGQRNKINDNLDELY
    Newman          DIKAFMGDTADGYAGVKGIGEKTAIKLIQQYQSVENVVENIDALSAGQRNKINDNLDELY
    USA300_FPR3757  DIKAFMGDTADGYAGVKGIGEKTAIKLIQQYQSVENVVENIDALSAGQRNKINDNLDELY
                    ************************************************************

    COL             LSKRLAEIHTQVPIDSEALFEKMSFATTLNHILSICNEHELHVSGKYISSHF
    N315            LSKRLAEIHTQVPIDSEALFEKMSFATTLNHILSICNEHELHVSGKYISSHF
    NCTC8325        LSKRLAEIHTQVPIDSEALFEKMSFATTLNHILSICNEHELHVSGKYISSHF
    Newman          LSKRLAEIHTQVPIDSEALFEKMSFATTLNHILSICNEHELHVSGKYISSHF
    USA300_FPR3757  LSKRLAEIHTQVPIDSEALFEKMSFATTLNHILSICNEHELHVSGKYISSHF
                    ****************************************************