Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search
NCBI: 10-JUN-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1332 [new locus tag: SAUSA300_RS07260 ]
  • pan locus tag?: SAUPAN003894000
  • symbol: SAUSA300_1332
  • pan gene symbol?:
  • synonym:
  • product: putative 5'-3' exonuclease

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAUSA300_1332 [new locus tag: SAUSA300_RS07260 ]
  • symbol: SAUSA300_1332
  • product: putative 5'-3' exonuclease
  • replicon: chromosome
  • strand: -
  • coordinates: 1494103..1494981
  • length: 879
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGCCTAATAAAATATTACTTGTAGATGGTATGGCGCTATTATTTAGACATTTCTATGCT
    ACAAGTCTTCATAAACAATTTATGTACAATTCACAAGGTGAACCTACAAATGGAATACAA
    GGATTTGTGCGTCATATCTTTTCGGCAATACATGAAATACGCCCTACACATGTAGCTGTA
    TGTTGGGATATGGGACAATCAACTTTTAGAAATGATATGTTTGATGGTTATAAGCAAAAT
    CGTTCTGCACCACCAGAAGAATTGATACCACAATTTGATTATGTTAAAGAAATTTCAGAG
    CAATTTGGCTTTGTAAATATTGGCGTTAAAAACTATGAAGCGGATGATGTTATAGGTACA
    TTAGCACAACAATATTCAACTGATAACGATGTCTATATTATTACGGGCGACAAAGATTTA
    CTGCAATGTATTAATGACAATGTTGAAGTTTGGCTAATTAAAAAAGGTTTTAACATTTAT
    AATAGATATACATTACATCGTTTTAACGAAGAATATGCCCTTGAACCACAACAACTAATC
    GATATTAAAGCGTTTATGGGTGATACAGCAGATGGATATGCGGGTGTTAAAGGTATTGGC
    GAGAAAACGGCTATTAAGTTAATTCAGCAATATCAAAGCGTTGAAAATGTGGTTGAAAAC
    ATTGATGCATTATCAGCTGGGCAACGTAATAAGATTAATGACAATTTAGATGAACTATAT
    TTATCGAAGCGACTGGCTGAAATTCACACACAAGTACCAATTGATAGTGAAGCGCTTTTT
    GAGAAAATGTCATTTGCAACAACGCTTAATCATATTTTATCAATTTGTAACGAACATGAA
    TTACATGTTTCAGGAAAATATATTTCATCCCATTTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    879

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAUSA300_1332 [new locus tag: SAUSA300_RS07260 ]
  • symbol: SAUSA300_1332
  • description: putative 5'-3' exonuclease
  • length: 292
  • theoretical pI: 5.04103
  • theoretical MW: 33401.5
  • GRAVY: -0.321918

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA polymerase I (TIGR00593; EC 2.7.7.7; HMM-score: 266.7)
    flap structure-specific endonuclease (TIGR03674; EC 3.1.-.-; HMM-score: 32)
    MetabolismAmino acid biosynthesisPyruvate familythreonine dehydratase (TIGR02079; EC 4.3.1.19; HMM-score: 14.8)
  • TheSEED:  
    DNA MetabolismDNA repairDNA Repair Base Excision DNA polymerase I (EC 2.7.7.7) 
    DNA replicationDNA-replication DNA polymerase I (EC 2.7.7.7) 
  • PFAM:
    PIN (CL0280) 5_3_exonuc_N; 5'-3' exonuclease, N-terminal resolvase-like domain (PF02739; HMM-score: 176.5)
    5_3_exonuc_C (CL0464) 5_3_exonuc; 5'-3' exonuclease, C-terminal SAM fold (PF01367; HMM-score: 94)
    HHH (CL0198) HHH_5; Helix-hairpin-helix domain (PF14520; HMM-score: 16.3)
    HHH_2; Helix-hairpin-helix motif (PF12826; HMM-score: 15.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 0.83
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.148
    • Ymax_pos: 25
    • Cmax: 0.151
    • Cmax_pos: 34
    • Smax: 0.295
    • Smax_pos: 6
    • Smean: 0.204
    • D: 0.17
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MPNKILLVDGMALLFRHFYATSLHKQFMYNSQGEPTNGIQGFVRHIFSAIHEIRPTHVAVCWDMGQSTFRNDMFDGYKQNRSAPPEELIPQFDYVKEISEQFGFVNIGVKNYEADDVIGTLAQQYSTDNDVYIITGDKDLLQCINDNVEVWLIKKGFNIYNRYTLHRFNEEYALEPQQLIDIKAFMGDTADGYAGVKGIGEKTAIKLIQQYQSVENVVENIDALSAGQRNKINDNLDELYLSKRLAEIHTQVPIDSEALFEKMSFATTLNHILSICNEHELHVSGKYISSHF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]