From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003897000
  • symbol?:
  • description?: sulfite reductase [NADPH] flavoprotein

      descriptions from strain specific annotations:

    • sulfite reductase [NADPH] flavoprotein
    • peptidase
    • pepSY-associated TM helix family protein
    • sulfite reductase [NADPH], flavoprotein, alpha subunit
    • putative iron-regulated membrane protein
    • Sulfite reductase flavoprotein alpha-component
    • pseudogene
    • sulfite reductase [NADPH] flavoprotein alpha-component
    • putative iron-regulated membrane protein , Iron-uptake factor PiuB
  • strand?: +
  • coordinates?: 4220537..4221917
  • synteny block?: BlockID0029430
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1397 (piuB)
    08BA02176:
    C248_1481
    11819-97:
    MS7_1398
    71193:
    ST398NM01_1441
    ECT-R 2:
    ECTR2_1296
    ED133:
    SAOV_1451
    ED98:
    SAAV_1426
    HO 5096 0412:
    SAEMRSA15_13040
    JH1:
    SaurJH1_1531
    JH9:
    SaurJH9_1502
    JKD6008:
    SAA6008_01410 (piuB)
    JKD6159:
    SAA6159_01307 (piuB)
    LGA251:
    SARLGA251_13570
    M013:
    M013TW_1389
    MRSA252:
    SAR1454
    MSHR1132:
    SAMSHR1132_12830
    MSSA476:
    SAS1385
    Mu3:
    SAHV_1430
    Mu50:
    SAV1442
    MW2:
    MW1331
    RF122:
    SAB1307
    ST398:
    SAPIG1441
    T0131:
    SAT0131_01530
    TCH60:
    HMPREF0772_11763
    TW20:
    SATW20_14420
    USA300_TCH1516:
    USA300HOU_1379
    VC40:
    SAVC_06465

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKNTFNPLQRLHFYAAIFIAPLLITLTISGIGYLFFPEVENNIYKNEFFGDSDVKTHQTL
    N315            MKNTFNPLQRLHFYAAIFIAPLLITLTISGIGYLFFPEVENNIYKNEFFGDSDVKTHQTL
    NCTC8325        MKNTFNPLQRLHFYAAIFIAPLLITLTISGIGYLFFPEVENNIYKNEFFGDSDVKTHQTL
    Newman          MKNTFNPLQRLHFYAAIFIAPLLITLTISGIGYLFFPEVENNIYKNEFFGDSDVKTHQTL
    USA300_FPR3757  MKNTFNPLQRLHFYAAIFIAPLLITLTISGIGYLFFPEVENNIYKNEFFGDSDVKTHQTL
                    ************************************************************

    COL             NDAVHQVEQQYEGFFVSKVSILDEPYNKRITLSDMAGNQRYVFLDHNNQFVADQNAKHTY
    N315            NDAVHQVEQQYEGFFVSKVSILDEPYNKRITLSDMAGNQRYVFLDHNNQFVADQNAKHTY
    NCTC8325        NDAVHQVEQQYEGFFVSKVSILDEPYNKRITLSDMAGNQRYVFLDHNNQFVADQNAKHTY
    Newman          NDAVHQVEQQYEGFFVSKVSILDEPYNKRITLSDMAGNQRYVFLDHNNQFVADQNAKHTY
    USA300_FPR3757  NDAVHQVEQQYEGFFVSKVSILDEPYNKRITLSDMAGNQRYVFLDHNNQFVADQNAKHTY
                    ************************************************************

    COL             SNVMRSIHSSLFTENTIINYLVELTACWMIFMILSGTYLLIKKHLISNKSKALRWQKWHA
    N315            SNVMRSIHSSLFTENTIINYLVELTACWTIFMILSGTYLLIKKHLISNKSKALRWQKWHA
    NCTC8325        SNVMRSIHSSLFTENTIINYLVELTACWMIFMILSGTYLLIKKHLISNKSKALRWQKWHA
    Newman          SNVMRSIHSSLFTENTIINYLVELTACWMIFMILSGTYLLIKKHLISNKSKALRWQKWHA
    USA300_FPR3757  SNVMRSIHSSLFTENTIINYLVELTACWMIFMILSGTYLLIKKHLISNKSKALRWQKWHA
                    **************************** *******************************

    COL             MIGVIIAIPVFVLVLTGLPWSGFMGSKIAGMMDTNGDLGQGELAINPPKSDLNELPWATR
    N315            MIGVIIAIPVFVLVLTGLPWSGFMGSKIAGMMDTNGDLGQGELAINPPKSDLNELPWATR
    NCTC8325        MIGVIIAIPVFVLVLTGLPWSGFMGSKIAGMMDTNGDLGQGELAINPPKSDLNELPWATR
    Newman          MIGVIIAIPVFVLVLTGLPWSGFMGSKIAGMMDTNGDLGQGELAINPPKSDLNELPWATR
    USA300_FPR3757  MIGVIIAIPVFVLVLTGLPWSGFMGSKIAGMMDTNGALGQGELAINPPKSDLNELPWATR
                    ************************************ ***********************

    COL             KNKQPASSEKGSSGHHGNAAMPQTKLDYQISIDKVVEQAQKAGIKKPFSIVYPSDKNGTF
    N315            KNKQPASSEKGSSGHHGNAAMPQTKLDYQISIDKVVVQAQKAGIKKPFSIVYPSDKNGTF
    NCTC8325        KNKQPASSEKGSSGHHGNAAMPQTKLDYQISIDKVVEQAQKAGIKKPFSIVYPSDKNGTF
    Newman          KNKQPASSEKGSSGHHGNAAMPQTKLDYQISIDKVVEQAQKAGIKKPFSIVYPSDKNGTF
    USA300_FPR3757  KNKQPASSEKGSSGHHGNAAMPQTKLDYQISIDKVVEQAQKAGIKKPFSIVYPSDKNGTF
                    ************************************ ***********************

    COL             IVSNTSNSGVTGLDVSPYKEQTLYFDQYSGKKLGTIKYDDYGIIAKWFTWGIPLHEGHLF
    N315            IVSNTSNSGVTGLDVSPYKEQTLYFDQYSGKKLGTIKYDDYGIIAKWFTWGIPLHEGHLF
    NCTC8325        IVSNTSNSGVTGLDVSPYKEQTLYFDQYSGKKLGTIKYDDYGIIAKWFTWGIPLHEGHLF
    Newman          IVSNTSNSGVTGLDVSPYKEQTLYFDQYSGKKLGTIKYDDYGIIAKWFTWGIPLHEGHLF
    USA300_FPR3757  IVSNTSNSGVTGLDVSPYKEQTLYFDQYSGKKLGTIKYDDYGIIAKWFTWGIPLHEGHLF
                    ************************************************************

    COL             GILNKIINLFVCIALLVAIGMGFVSWIKRTKNTAVKVTHRVKKPASISLIICLIVLGLLM
    N315            GILNKIINLFVCITLLVAIGMGFVSWIKRTKNTAVKVPHRVKKPASISLIICLIVLGLLM
    NCTC8325        GILNKIINLFVCIALLVAIGMGFVSWIKRTKNTAVKVPHRVKKPASISLIICLIVLGLLM
    Newman          GILNKIINLFVCIALLVAIGMGFVSWIKRTKNTAVKVTHRVKKPASISLIICLIVLGLLM
    USA300_FPR3757  GILNKIINLFVCIALLVAIGMGFVSWIKRTKNTAIKVPHRVKKPASISLIICLIVLGLLM
                    *************:********************:**.**********************

    COL             PLFGLSLILVFIIELILYIKDRRAKQ
    N315            PLFGLSLILVFIIELILYIKDRRAKQ
    NCTC8325        PLFGLSLILVFIIELILYIKDRRAKQ
    Newman          PLFGLSLILVFIIELILYIKDRRAKQ
    USA300_FPR3757  PLFGLSLILVFIIELILYIKDRRAKQ
                    **************************