From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003909000
  • symbol?: recU
  • description?: Holliday junction-specific endonuclease

      descriptions from strain specific annotations:

    • Holliday junction-specific endonuclease
    • Recombination protein RecU
    • recombination protein U
    • putative recombination protein U
    • Holliday junction resolvase recU
  • strand?: +
  • coordinates?: 4226672..4227349
  • synteny block?: BlockID0029550
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1489 (recU)
    N315:
    SA1282 (recU)
    NCTC8325:
    Newman:
    NWMN_1360 (recU)
    USA300_FPR3757:
    04-02981:
    SA2981_1405 (recU)
    08BA02176:
    C248_1489 (recU)
    11819-97:
    MS7_1405 (recU)
    71193:
    ST398NM01_1449
    ECT-R 2:
    ECTR2_1303 (recU)
    ED133:
    SAOV_1457 (recU)
    ED98:
    SAAV_1436 (recU)
    HO 5096 0412:
    SAEMRSA15_13100 (recU)
    JH1:
    SaurJH1_1537 (recU)
    JH9:
    SaurJH9_1508 (recU)
    JKD6008:
    SAA6008_01418 (recU)
    JKD6159:
    SAA6159_01314 (recU)
    LGA251:
    SARLGA251_13630 (recU)
    M013:
    M013TW_1397
    MRSA252:
    SAR1460 (recU)
    MSHR1132:
    SAMSHR1132_12890
    MSSA476:
    SAS1392 (recU)
    Mu3:
    SAHV_1437 (recU)
    Mu50:
    SAV1449 (recU)
    MW2:
    MW1339 (recU)
    RF122:
    SAB1313 (recU)
    ST398:
    SAPIG1449 (recU)
    T0131:
    SAT0131_01538 (apbA)
    TCH60:
    HMPREF0772_11755 (recU)
    TW20:
    SATW20_14480 (recU)
    USA300_TCH1516:
    USA300HOU_1387 (recU)
    VC40:
    SAVC_06500 (recU)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -----------------MNYPNGKPYRKNSAIDGGKKTAAFSNIEYGGRGMSLEKDIEHS
    N315            -----------------MNYPNGKPYRKNSAIDGGKKTAAFSNIEYGGRGMSLEKDIEHS
    NCTC8325        MLCIINNVYYQTCVVKFMNYPNGKPYRKNSAIDGGKKTAAFSNIEYGGRGMSLEKDIEHS
    Newman          MLCIINNVYYQTCVVKFMNYPNGKPYRKNSAIDGGKKTAAFSNIEYGGRGMSLEKDIEHS
    USA300_FPR3757  -----------------MNYPNGKPYRKNSAIDGGKKTAAFSNIEYGGRGMSLEKDIEHS
                                     *******************************************

    COL             NTFYLKSDIAVIHKKPTPVQIVNVNYPKRSKAVINEAYFRTPSTTDYNGVYQGYYIDFEA
    N315            NTFYLKSDIAVIHKKPTPVQIVNVNYPKRSKAVINEAYFRTPSTTDYNGVYQGYYIDFEA
    NCTC8325        NTFYLKSDIAVIHKKPTPVQIVNVNYPKRSKAVINEAYFRTPSTTDYNGVYQGYYIDFEA
    Newman          NTFYLKSDIAVIHKKPTPVQIVNVNYPKRSKAVINEAYFRTPSTTDYNGVYQGYYIDFEA
    USA300_FPR3757  NTFYLKSDIAVIHKKPTPVQIVNVNYPKRSKAVINEAYFRTPSTTDYNGVYQGYYIDFEA
                    ************************************************************

    COL             KETKNKTSFPLNNIHDHQVEHMKNAYQQKGIVFLMIRFKTLDEVYLLPYSKFEVFWKRYK
    N315            KETKNKTSFPLNNIHDHQVEHMKNAYQQKGIVFLMIRFKTLDEVYLLPYSKFEVFWKRYK
    NCTC8325        KETKNKTSFPLNNIHDHQVEHMKNAYQQKGIVFLMIRFKTLDEVYLLPYSKFEVFWKRYK
    Newman          KETKNKTSFPLNNIHDHQVEHMKNAYQQKGIVFLMIRFKTLDEVYLLPYSKFEVFWKRYK
    USA300_FPR3757  KETKNKTSFPLNNIHDHQVEHMKNAYQQKGIVFLMIRFKTLDEVYLLPYSKFEVFWKRYK
                    ************************************************************

    COL             DNIKKSITVDEIRKNGYHIPYQYQPRLDYLKAVDKLILDESEDRV
    N315            DNIKKSITVDEIRKNGYHIPYQYQPRLDYLKAVDKLILDESEDRV
    NCTC8325        DNIKKSITVDEIRKNGYHIPYQYQPRLDYLKAVDKLILDESEDRV
    Newman          DNIKKSITVDEIRKNGYHIPYQYQPRLDYLKAVDKLILDESEDRV
    USA300_FPR3757  DNIKKSITVDEIRKNGYHIPYQYQPRLDYLKAVDKLILDESEDRV
                    *********************************************