From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1282 [new locus tag: SA_RS07265 ]
  • pan locus tag?: SAUPAN003909000
  • symbol: recU
  • pan gene symbol?: recU
  • synonym:
  • product: Holliday junction-specific endonuclease

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1282 [new locus tag: SA_RS07265 ]
  • symbol: recU
  • product: Holliday junction-specific endonuclease
  • replicon: chromosome
  • strand: +
  • coordinates: 1486033..1486659
  • length: 627
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAATTATCCAAATGGTAAACCATATCGTAAAAATAGTGCTATAGACGGAGGGAAAAAG
    ACCGCTGCCTTTAGTAATATTGAGTATGGTGGACGTGGTATGTCACTTGAAAAAGATATC
    GAACATTCAAATACGTTTTATCTTAAAAGCGACATTGCAGTTATTCACAAAAAGCCTACG
    CCAGTACAAATAGTTAATGTCAACTATCCTAAGCGGAGTAAAGCTGTGATTAACGAAGCT
    TATTTTCGTACACCTTCAACAACTGATTACAACGGCGTTTATCAAGGTTATTATATTGAT
    TTTGAAGCAAAGGAAACTAAAAACAAGACGTCCTTTCCTTTAAATAATATTCATGACCAT
    CAAGTCGAACATATGAAAAATGCATATCAACAAAAAGGTATTGTGTTTTTAATGATTCGT
    TTTAAAACGCTAGATGAAGTTTATCTTTTACCCTATTCAAAATTCGAAGTATTTTGGAAG
    AGATATAAAGATAATATTAAAAAGTCTATAACAGTTGATGAAATACGAAAAAATGGTTAC
    CATATTCCTTATCAGTATCAACCAAGATTAGACTATCTAAAAGCAGTTGATAAGTTGATA
    TTAGATGAAAGTGAGGACCGCGTATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    627

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1282 [new locus tag: SA_RS07265 ]
  • symbol: RecU
  • description: Holliday junction-specific endonuclease
  • length: 208
  • theoretical pI: 9.7137
  • theoretical MW: 24443.6
  • GRAVY: -0.771635

Function[edit source | edit]

  • reaction:
    EC 3.1.22.-?  ExPASy
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairrecombination protein U (TIGR00648; EC 3.1.-.-; HMM-score: 310.5)
  • TheSEED:  
    Cell Division and Cell CycleCell Division and Cell Cycle - no subcategoryControl of cell elongation - division cycle in Bacilli RecU Holliday junction resolvase 
  • PFAM:
    PDDEXK (CL0236) RecU; Recombination protein U (PF03838; HMM-score: 221.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0.24
    • Cytoplasmic Membrane Score: 0.05
    • Cellwall Score: 0.8
    • Extracellular Score: 8.91
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.177
    • Ymax_pos: 11
    • Cmax: 0.107
    • Cmax_pos: 44
    • Smax: 0.41
    • Smax_pos: 10
    • Smean: 0.318
    • D: 0.232
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNYPNGKPYRKNSAIDGGKKTAAFSNIEYGGRGMSLEKDIEHSNTFYLKSDIAVIHKKPTPVQIVNVNYPKRSKAVINEAYFRTPSTTDYNGVYQGYYIDFEAKETKNKTSFPLNNIHDHQVEHMKNAYQQKGIVFLMIRFKTLDEVYLLPYSKFEVFWKRYKDNIKKSITVDEIRKNGYHIPYQYQPRLDYLKAVDKLILDESEDRV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]