From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003913000
  • symbol?: dnaD
  • description?: primosomal protein DnaD

      descriptions from strain specific annotations:

    • primosomal protein DnaD
    • primosome subunit DnaD
    • DNA replication protein DnaD, putative
    • Chromosome replication initiation protein dnaD
    • dnaD and phage-associated domain protein
    • dnaD domain protein
    • DNA replication protein, DnaD
    • DNA replication initiation protein
    • putative DNA replication protein DnaD
    • DNA-binding protein
  • strand?: -
  • coordinates?: 4231315..4232001
  • synteny block?: BlockID0029590
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1364 (dnaD)
    USA300_FPR3757:
    04-02981:
    SA2981_1409 (dnaD)
    08BA02176:
    C248_1493
    11819-97:
    MS7_1409
    71193:
    ST398NM01_1453
    ECT-R 2:
    ECTR2_1307
    ED133:
    SAOV_1461
    ED98:
    SAAV_1440
    HO 5096 0412:
    SAEMRSA15_13140
    JH1:
    SaurJH1_1541
    JH9:
    SaurJH9_1512
    JKD6008:
    SAA6008_01422 (dnaD)
    JKD6159:
    SAA6159_01318 (dnaD)
    LGA251:
    SARLGA251_13670
    M013:
    M013TW_1401
    MRSA252:
    SAR1464
    MSHR1132:
    SAMSHR1132_12930
    MSSA476:
    SAS1396
    Mu3:
    SAHV_1441
    Mu50:
    SAV1453
    MW2:
    MW1343
    RF122:
    SAB1317c
    ST398:
    SAPIG1453
    T0131:
    SAT0131_01542
    TCH60:
    HMPREF0772_11751 (dnaD)
    TW20:
    SATW20_14520
    USA300_TCH1516:
    USA300HOU_1391 (dnaD1)
    VC40:
    SAVC_06520

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDKYQLKARPVVIRRELLDHYSDLGLDEQDLVILLKLIYASETSNKQPSIELLQKGSTMQ
    N315            MDKYQLKARPVVIRRELLDHYSDLGLDEQDLVILLKLIYASETSNKQPSIELLQKGSTMQ
    NCTC8325        MDKYQLKARPVVIRRELLDHYSDLGLDEQDLVILLKLIYASETSNKQPSIELLQKGSTMQ
    Newman          MDKYQLKARPVVIRRELLDHYSDLGLDEQDLVILLKLIYASETSNKQPSIELLQKGSTMQ
    USA300_FPR3757  MDKYQLKARPVVIRRELLDHYSDLGLDEQDLVILLKLIYASETSNKQPSIELLQKGSTMQ
                    ************************************************************

    COL             PRDITMVIQNLIQRELLELQVQKDEEGRFTEYMNLDPFFEKLSHILKQQSMETKELNSKE
    N315            PRDITMVIQNLIQRELLELQVQKDEEGRFTEYMNLDPFFEKLSHILKQQSMETKEQNSKE
    NCTC8325        PRDITMVIQNLIQRELLELQVQKDEEGRFTEYMNLDPFFEKLSHILKQQSMETKELNSKE
    Newman          PRDITMVIQNLIQRELLELQVQKDEEGRFTEYMNLDPFFEKLSHILKQQSMETKELNSKE
    USA300_FPR3757  PRDITMVIQNLIQRELLELQVQKDEEGRFTEYMNLDPFFEKLSHILKQQSMETKELNSKE
                    ******************************************************* ****

    COL             KFKQLFRVLEDTFARPLSPYEIETLNQWIDVDKHDTAIIQAALDEANSLNKLSFKYIDRI
    N315            KFKQLFRVLEDTFARPLSPYEIETLNQWIDVDKHDSAIIQAALDEANSLNKLSFKYMDRI
    NCTC8325        KFKQLFRVLEDTFARPLSPYEIETLNQWIDVDKHDTAIIQAALDEANSLNKLSFKYIDRI
    Newman          KFKQLFRVLEDTFARPLSPYEIETLNQWIDVDKHDTAIIQAALDEANSLNKLSFKYIDRI
    USA300_FPR3757  KFKQLFRVLEDTFARPLSPYEIETLNQWIDVDKHDTAIIQAALDEANSLNKLSFKYIDRI
                    ***********************************:********************:***

    COL             LLNWKKNNVKTIDDSRKIREKFNKPKMTHTVKTVPKFDWLNGENLDGK
    N315            LLNWKKNNVKTIDDSRKIREKFNKPKMTHTVKTVPKFDWLNGENLDGK
    NCTC8325        LLNWKKNNVKTIDDSRKIREKFNKPKMTHTVKTVPKFDWLNGENLDGK
    Newman          LLNWKKNNVKTIDDSRKIREKFNKPKMTHTVKTVPKFDWLNGENLDGK
    USA300_FPR3757  LLNWKKNNVKTIDDSRKIREKFNKPKMTHTVKTVPKFDWLNGENLDGK
                    ************************************************