From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003917000
  • symbol?: papS
  • description?: tRNA CCA-pyrophosphorylase

      descriptions from strain specific annotations:

    • tRNA CCA-pyrophosphorylase
    • tRNA nucleotidyltransferase
    • poly A polymerase head domain protein
    • cca-adding enzyme (trnanucleotidyltransferase) (trna adenylyl-/cytidylyl-transferase) (trnacca-pyrophosphorylase) (trna-nt)
    • poly A polymerase family protein
    • polynucleotide adenylyltransferase
    • CCA-adding enzyme
  • strand?: -
  • coordinates?: 4237704..4238907
  • synteny block?: BlockID0029630
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1497 (papS)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1413
    08BA02176:
    C248_1497 (papS)
    11819-97:
    MS7_1413
    71193:
    ST398NM01_1457
    ECT-R 2:
    ECTR2_1311
    ED133:
    SAOV_1465 (papS)
    ED98:
    SAAV_1444 (papS)
    HO 5096 0412:
    SAEMRSA15_13180 (papS)
    JH1:
    SaurJH1_1545
    JH9:
    SaurJH9_1516
    JKD6008:
    SAA6008_01426 (papS)
    JKD6159:
    SAA6159_01322 (papS)
    LGA251:
    SARLGA251_13710 (papS)
    M013:
    M013TW_1405
    MRSA252:
    SAR1468 (papS)
    MSHR1132:
    SAMSHR1132_12970
    MSSA476:
    SAS1400
    Mu3:
    SAHV_1445
    Mu50:
    SAV1457
    MW2:
    MW1347
    RF122:
    SAB1321c (papS)
    ST398:
    SAPIG1457
    T0131:
    SAT0131_01546
    TCH60:
    HMPREF0772_11747 (papS)
    TW20:
    SATW20_14560 (papS)
    USA300_TCH1516:
    USA300HOU_1395 (pcnB)
    VC40:
    SAVC_06540

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDKSLFEQARPILEQIQDNGFEAYYVGGSVRDYVMGRNIHDIDITTSATPDEIESIFSHT
    N315            MDKSLFEQARPILEQIQDNGFEAYYVGGSVRDYVMGRNIHDIDITTSATPDEIESIFSHT
    NCTC8325        MDKSLFEQARPILEQIQDNGFEAYYVGGSVRDYVMGRNIHDIDITTSATPDEIESIFSHT
    Newman          MDKSLFEQARPILEQIQDNGFEAYYVGGSVRDYVMGRNIHDIDITTSATPDEIESIFSHT
    USA300_FPR3757  MDKSLFEQARPILEQIQDNGFEAYYVGGSVRDYVMGRNIHDIDITTSATPDEIESIFSHT
                    ************************************************************

    COL             IPVGKEHGTINVVFNDENYEVTTFRAEEDYVDHRRPSGVTFVRDLYEDLQRRDFTMNAIA
    N315            IPVGKEHGTINVVFNDENYEVTTFRAEEDYVDHRRPSGVTFVRDLYEDLQRRDFTMNAIA
    NCTC8325        IPVGKEHGTINVVFNDENYEVTTFRAEEDYVDHRRPSGVTFVRDLYEDLQRRDFTMNAIA
    Newman          IPVGKEHGTINVVFNDENYEVTTFRAEEDYVDHRRPSGVTFVRDLYEDLQRRDFTMNAIA
    USA300_FPR3757  IPVGKEHGTINVVFNDENYEVTTFRAEEDYVDHRRPSGVTFVRDLYEDLQRRDFTMNAIA
                    ************************************************************

    COL             MDTAYKLYDYFDGQQDINNRIIRTVGIAEERFQEDALRMIRCLRFQSQLSFDIATETFEA
    N315            MDTAYKLYDYFDGQQDINNRIIRTVGIAEERFQEDALRMIRCLRFQSQLSFDIAMETFEA
    NCTC8325        MDTAYKLYDYFDGQQDINNRIIRTVGIAEERFQEDALRMIRCLRFQSQLSFDIATETFEA
    Newman          MDTAYKLYDYFDGQQDINNRIIRTVGIAEERFQEDALRMIRCLRFQSQLSFDIATETFEA
    USA300_FPR3757  MDTAYKLYDYFDGQQDINNRIIRTVGIAEERFQEDALRMIRCLRFQSQLSFDIATETFEA
                    ****************************************************** *****

    COL             MRIQMADIKFLSIERIVIELTKLMRGINVEKSFNHLKSLKAFNYMPYFEHLDMNQINVTE
    N315            MRTQMADIKFLSIERIVIELTKLMRGINVEESFNHLKSLKAFNYMPYFEQLDMNQINVTE
    NCTC8325        MRIQMADIKFLSIERIVIELTKLMRGINVEKSFNHLKSLKAFNYMPYFEHLDMNQINVTE
    Newman          MRIQMADIKFLSIERIVIELTKLMRGINVEKSFNHLKSLKAFNYMPYFEHLDMNQINVTE
    USA300_FPR3757  MRIQMADIKFLSIERIVIELTKLMRGINVEKSFNHLKSLKAFNYMPYFEHLDMNQINVTE
                    ** ***************************:******************:**********

    COL             AIDLELLIAIVSVKFDINYSLKPLKLSNRQVKDINQYIQIMNALPSIITKEQLKMFVYDY
    N315            PIDLELLIAIVSVKFDINYSLKPLKLSNRQVKDINQYIQIMNALPSIITKEQLKMFVYDY
    NCTC8325        AIDLELLIAIVSVKFDINYSLKPLKLSNRQVKDINQYIQIMNALPSIITKEQLKMFVYDY
    Newman          AIDLELLIAIVSVKFDINYSLKPLKLSNRQVKDINQYIQIMNALPSIITKEQLKMFVYDY
    USA300_FPR3757  AIDLELLIAIVSVKFDINYSLKPLKLSNRQVKDINQYIQIMNALPSIITKEQLKMFVYDY
                    .***********************************************************

    COL             DTHLIKNVMVAADVLKANDIQGHEPLIVNLQTIDETLHRLPMHNRKDMMVNGGVLMAHLN
    N315            DTNLIKNVMVAADVLKANDIQGHEPLIVNLQTIDETLHRLPMHNRKDMMVNGGVLMAHLN
    NCTC8325        DTHLIKNVMVAADVLKANDIQGHEPLIVNLQTIDETLHRLPMHNRKDMMVNGGVLMAHLN
    Newman          DTHLIKNVMVAADVLKANDIQGHEPLIVNLQTIDETLHRLPMHNRKDMMVNGGVLMAHLN
    USA300_FPR3757  DTHLIKNVMVAADVLKANDIQGHEPLIVNLQTIDETLHRLPMHNRKDMMVNGGVLMAHLN
                    **:*********************************************************

    COL             AKSGPWLKDVLRQIEIAIVTGKVSNEETEILKWVDNHVKI
    N315            AKSGPWLKDVLRQIEIAIVTGKVSNEETEILKWVDNHVKI
    NCTC8325        AKSGPWLKDVLRQIEIAIVTGKVSNEETEILKWVDNHVKI
    Newman          AKSGPWLKDVLRQIEIAIVTGKVSNEETEILKWVDNHVKI
    USA300_FPR3757  AKSGPWLKDVLRQIEIAIVTGKVSNEETEILKWVDNHVKI
                    ****************************************