From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003922000
  • symbol?:
  • description?: IDEAL domain protein

      descriptions from strain specific annotations:

    • IDEAL domain protein
    • domain family
  • strand?: -
  • coordinates?: 4242942..4243521
  • synteny block?: BlockID0029680
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1418
    08BA02176:
    C248_1502
    11819-97:
    MS7_1418
    71193:
    ST398NM01_1462
    ECT-R 2:
    ECTR2_1316
    ED133:
    SAOV_1470
    ED98:
    SAAV_1449
    HO 5096 0412:
    SAEMRSA15_13230
    JH1:
    SaurJH1_1550
    JH9:
    SaurJH9_1521
    JKD6008:
    SAA6008_01431
    JKD6159:
    SAA6159_01327
    LGA251:
    SARLGA251_13760
    M013:
    M013TW_1410
    MRSA252:
    SAR1473
    MSHR1132:
    SAMSHR1132_13020
    MSSA476:
    SAS1405
    Mu3:
    SAHV_1450
    Mu50:
    SAV1462
    MW2:
    MW1352
    RF122:
    SAB1326c
    ST398:
    SAPIG1462
    T0131:
    SAT0131_01551
    TCH60:
    HMPREF0772_11742
    TW20:
    SATW20_14610
    USA300_TCH1516:
    USA300HOU_1400
    VC40:
    SAVC_06565

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSETFNQIKESFIEYLLFQYRFKSRIAVWVLNYIKVNEAKLANIHFVDTKINHHETLEIA
    N315            MSETLNQIKESFIEYLLFQYRFKSRIAVWVLNYIKVNEAKLANIHFVDTKINHHETLEIA
    NCTC8325        MSETLNQIKESFIEYLLFQYRFKSRIAVWVLNYIKVNEAKLANIHFVDTKINHHETLEIA
    Newman          MSETFNQIKESFIEYLLFQYRFKSRIAVWVLNYIKVNEAKLANIHFVDTKINHHETLEIA
    USA300_FPR3757  MSETFNQIKESFIEYLLFQYRFKSRIAVWVLNYIKVNEAKLANIHFVDTKINHHETLEIA
                    ****:*******************************************************

    COL             EVGSHASAIQFTKRNIKLMNTNEIFDYIANHNCAFDIQIHFANVSKREQRLDDLIVAQLT
    N315            EVGSHASAIQFTKRNIKLMNTNEIFDYIANHNCAFDIQIHFANVSKREQRLDDLIVAQLT
    NCTC8325        EVGSHASAIQFTKRNIKLMNTNEIFDYIANHNCAFDIQIHFANVSKREQRLDDLIVAQLT
    Newman          EVGSHASAIQFTKRNIKLMNTNEIFDYIANHNCAFDIQIHFANVSKREQRLDDLIVAQLT
    USA300_FPR3757  EVGSHASAIQFTKRNIKLMNTNEIFDYIANHNCAFDIQIHFANVSKREQRLDDLIVAQLT
                    ************************************************************

    COL             ESPSYQTYLHDLNSMAIDRHKHALLIDYLLHNIDLSLQMNEKQRFYQLTQILNTLKLVNK
    N315            ESPSYQTYLHDLNSMAIDRHKHALLIDYLLHNIDLSLQMNEKQRFYQLTQILNTLKLVNK
    NCTC8325        ESPSYQTYLHDLNSMAIDRHKHALLIDYLLHNIDLSLQMNEKQRFYQLTQILNTLKLVNK
    Newman          ESPSYQTYLHDLNSMAIDRHKHALLIDYLLHNIDLSLQMNEKQRFYQLTQILNTLKLVNK
    USA300_FPR3757  ESPSYQTYLHDLNSMAIDRHKHALLIDYLLHNIDLSLQMNEKQRFYQLTQILNTLKLVNK
                    ************************************************************

    COL             HNQFEDLADDN
    N315            HNQFEDLADDD
    NCTC8325        HNQFEDLADDN
    Newman          HNQFEDLADDN
    USA300_FPR3757  HNQFEDLADDN
                    **********: