From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003923000
  • symbol?:
  • description?: TPR-repeat-containing protein, putative component of Menaquinone-cytochrome C reductase

      descriptions from strain specific annotations:

    • TPR-repeat-containing protein, putative component of Menaquinone-cytochrome C reductase
    • putative PEP-CTERM system TPR-repeat lipoprotein
    • anaphase-promoting complex, cyclosome, subunit 3 family protein
    • tetratricopeptide (TPR) domain protein
    • tetratricopeptide repeat domain protein
  • strand?: -
  • coordinates?: 4243535..4244638
  • synteny block?: BlockID0029690
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1419
    08BA02176:
    C248_1503
    11819-97:
    MS7_1419
    71193:
    ST398NM01_1463
    ECT-R 2:
    ECTR2_1317
    ED133:
    SAOV_1471
    ED98:
    SAAV_1450
    HO 5096 0412:
    SAEMRSA15_13240
    JH1:
    SaurJH1_1551
    JH9:
    SaurJH9_1522
    JKD6008:
    SAA6008_01432
    JKD6159:
    SAA6159_01328
    LGA251:
    SARLGA251_13770
    M013:
    M013TW_1411
    MRSA252:
    SAR1474
    MSHR1132:
    SAMSHR1132_13030
    MSSA476:
    SAS1406
    Mu3:
    SAHV_1451
    Mu50:
    SAV1463
    MW2:
    MW1353
    RF122:
    SAB1327c
    ST398:
    SAPIG1463
    T0131:
    SAT0131_01552
    TCH60:
    HMPREF0772_11741
    TW20:
    SATW20_14620
    USA300_TCH1516:
    USA300HOU_1401
    VC40:
    SAVC_06570

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEDIYKLIDDINLQKLENLDSRVNEAITTDNDDALFILGETLYNFGLMPQGLEVFRVLYH
    N315            MEDIYKLIDDINLQKLENLDSRVNEAITTDNDDALFILGETLYNFGLMPQGLEVFRVLYH
    NCTC8325        -----------------------------------------------MPQGLEVFRVLYH
    Newman          MEDIYKLIDDINLQKLENLDSRVNEAITTDNDDALFILGETLYNFGLMPQGLEVFRVLYH
    USA300_FPR3757  -----------------------------------------------MPQGLEVFRVLYH
                                                                   *************

    COL             KYPDESELLIYFIEGLMSENQTDEALEYLSYVEPSPEKLMLEADLYQQINMMEVAIDKLQ
    N315            KYPDESELLIYFIEGLMSENQTDEALEYLSYVEPSPEKLMLEADLYQQINMMEVAIDKLQ
    NCTC8325        KYPDESELLIYFIEGLMSENQTDEALEYLSYVEPSPEKLMLEADLYQQINMMEVAIDKLQ
    Newman          KYPDESELLIYFIEGLMSENQTDEALEYLSYVEPSPEKLMLEADLYQQINMMEVAIDKLQ
    USA300_FPR3757  KYPDESELLIYFIEGLMSENQTDEALEYLSYVEPSPEKLMLEADLYQQINMMEVAIDKLQ
                    ************************************************************

    COL             EALELEPNDPIIHFALAEMLYYDGQYLRATSEYETVLETGEYQVNGVNLFSRMADCSLQS
    N315            EALELEPNDPIIHFALAEMLYYDGQYLRATSEYETVLETGEYQVNGVNLFSRMADCSLQS
    NCTC8325        EALELEPNDPIIHFALAEMLYYDGQYLRATSEYETVLETGEYQVNGVNLFSRMADCSLQS
    Newman          EALELEPNDPIIHFALAEMLYYDGQYLRATSEYETVLETGEYQVNGVNLFSRMADCSLQS
    USA300_FPR3757  EALELEPNDPIIHFALAEMLYYDGQYLRATSEYETVLETGEYQVNGVNLFSRMADCSLQS
                    ************************************************************

    COL             GNYSDAIRLYDEINEDEMTSEDYLKKAISYDKNDITQEAIKIMTTLLSKDPDYIQGYLYL
    N315            GNYSDAIRLYDEINEDEMTSEDYLKKAISYDKNDITQEAIKIMTTLLSKDPDYIQGYLYL
    NCTC8325        GNYSDAIRLYDEINEDEMTSEDYLKKAISYDKNDITQEAIKIMTTLLSKDPDYIQGYLYL
    Newman          GNYSDAIRLYDEINEDEMTSEDYLKKAISYDKNDITQEAIKIMTTLLSKDPDYIQGYLYL
    USA300_FPR3757  GNYSDAIRLYDEINEDEMTSEDYLKKAISYDKNDITQEAIKIMTTLLSKDPDYIQGYLYL
                    ************************************************************

    COL             QSLYENEKNYPDAIETGKEGLRLSQFYKELMYTTGCLEIEHGDANEGVLLLKQALEVDNA
    N315            QSLYENEKNYPDAIETGKEGLRLSQFYKELMYTTGCLEIEHGDANEGVLLLKQALEVDNA
    NCTC8325        QSLYENEKNYPDAIETGKEGLRLSQFYKELMYTTGCLEIEHGDANEGVLLLKQALEVDNA
    Newman          QSLYENEKNYPDAIETGKEGLRLSQFYKELMYTTGCLEIEHGDANEGVLLLKQALEVDNA
    USA300_FPR3757  QSLYENEKNYPDAIETGKEGLRLSQFYKELMYTTGCLEIEHGDANEGVLLLKQALEVDNA
                    ************************************************************

    COL             YQEPLLILSDLYRNEEDYEAIIELLTYVDEEDLDPTFMWHLAFAYGQEERDKEAQHFFEL
    N315            YQEPLLILSDLYRNEEDYEAIIELLTYVDEEDLDPTFMWHLAFAYGQEERDKEAQHFFEL
    NCTC8325        YQEPLLILSDLYRNEEDYEAIIELLTYVDEEDLDPTFMWHLAFAYGQEERDKEAQHFFEL
    Newman          YQEPLLILSDLYRNEEDYEAIIELLTYVDEEDLDPTFMWHLAFAYGQEERDKEAQHFFEL
    USA300_FPR3757  YQEPLLILSDLYRNEEDYEAIIELLTYVDEEDLDPTFMWHLAFAYGQEERDKEAQHFFEL
                    ************************************************************

    COL             AYPTMKTNIDFMSDYYFYLIEIGQKEQAITILNQLLELEPSNENWHDELSRLQS
    N315            AYPTMKTNIDFMSDYYFYLIEIGQKEQAITILNQLLELEPSNENWHDELSRLQS
    NCTC8325        AYPTMKTNIDFMSDYYFYLIEIGQKEQAITILNQLLELEPSNENWHDELSRLQS
    Newman          AYPTMKTNIDFMSDYYFYLIEIGQKEQAITILNQLLELEPSNENWHDELSRLQS
    USA300_FPR3757  AYPTMKTNIDFMSDYYFYLIEIGQKEQAITILNQLLELEPSNENWHDELSRLQS
                    ******************************************************