From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004024000
  • symbol?: srrB
  • description?: two-component sensor histidine kinase

      descriptions from strain specific annotations:

    • two-component sensor histidine kinase
    • respiratory response protein SrrB
    • sensor histidine kinase SrrB
    • respiratory response protein, SrrB
    • sensor protein srrB (Staphylococcal respiratory responseprotein B)
    • integral membrane sensor signal transduction histidine kinase
    • Osmosensitive K+ channel histidine kinase KdpD
    • ResE
    • respiratory response protein B
    • sensor kinase protein
    • sensor kinase SrrB
    • Sensor protein srrB
    • staphylococcal respiratory response protein B
    • Staphylococcal respiratory response protein SrrB
  • strand?: -
  • coordinates?: 4314705..4316399
  • synteny block?: BlockID0030610
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1534 (srrB)
    N315:
    SA1322 (srrB)
    NCTC8325:
    Newman:
    NWMN_1399 (srrB)
    USA300_FPR3757:
    04-02981:
    SA2981_1448 (srrB)
    08BA02176:
    C248_1531 (srrB)
    11819-97:
    MS7_1508 (srrB)
    71193:
    ST398NM01_1557
    ECT-R 2:
    ECTR2_1342
    ED133:
    SAOV_1493
    ED98:
    SAAV_1481 (srrB)
    HO 5096 0412:
    SAEMRSA15_14130 (srrB)
    JH1:
    SaurJH1_1579
    JH9:
    SaurJH9_1548
    JKD6008:
    SAA6008_01461 (srrB)
    JKD6159:
    SAA6159_01420 (srrB)
    LGA251:
    SARLGA251_13990 (srrB)
    M013:
    M013TW_1505
    MRSA252:
    SAR1567 (srrB)
    MSHR1132:
    SAMSHR1132_13300
    MSSA476:
    SAS1431
    Mu3:
    SAHV_1479 (srrB)
    Mu50:
    SAV1491 (srrB)
    MW2:
    MW1445 (srrB)
    RF122:
    SAB1352c (srrB)
    ST398:
    SAPIG1557
    T0131:
    SAT0131_01584
    TCH60:
    HMPREF0772_11650 (srrB)
    TW20:
    SATW20_14890 (srrB)
    USA300_TCH1516:
    USA300HOU_1493 (srrB)
    VC40:
    SAVC_06705

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -----MMSRLNSVVIKLWLTIILIVTTVLILLSIALITFMQYYFTQETENAIREDARRIS
    N315            MRLNLMMSRLNSVVIKLWLTIILIVTTVLILLSIALITFMQYYFTQETENAIREDARRIS
    NCTC8325        -----MMSRLNSVVIKLWLTIILIVTTVLILLSIALITFMQYYFTQETENAIREDARRIS
    Newman          -----MMSRLNSVVIKLWLTIILIVTTVLILLSIALITFMQYYFTQETENAIREDARRIS
    USA300_FPR3757  MRLNLMMSRLNSVVIKLWLTIILIVTTVLILLSIALITFMQYYFTQETENAIREDARRIS
                         *******************************************************

    COL             SLVEQSHNKEEAIKYSQTLIENPGGLMIINNKHRQSTASLSNIKKQMLNEVVNNDHFDDV
    N315            SLVEQSHNKEEAIKYSQTLIENPGGLMIINNKHRQSTASLSNIKKQMLNEVVNNDHFDDV
    NCTC8325        SLVEQSHNKEEAIKYSQTLIENPGGLMIINNKHRQSTASLSNIKKQMLNEVVNNDHFDDV
    Newman          SLVEQSHNKEEAIKYSQTLIENPGGLMIINNKHRQSTASLSNIKKQMLNEVVNNDHFDDV
    USA300_FPR3757  SLVEQSHNKEEAIKYSQTLIENPGGLMIINNKHRQSTASLSNIKKQMLNEVVNNDHFDDV
                    ************************************************************

    COL             FDKGKSVTRNVTIKEKGSSQTYILLGYPTKAQKNSHSKYSGVFIYKDLKSIEDTNNAITI
    N315            FDKGKSVTRNVTIKEKGSSQTYILLGYPTKAQKNSHSKYSGVFIYKDLKSIEDTNNAITI
    NCTC8325        FDKGKSVTRNVTIKEKGSSQTYILLGYPTKAQKNSHSKYSGVFIYKDLKSIEDTNNAITI
    Newman          FDKGKSVTRNVTIKEKGSSQTYILLGYPTKAQKNSHSKYSGVFIYKDLKSIEDTNNAITI
    USA300_FPR3757  FDKGKSVTRNVTIKEKGSSQTYILLGYPTKAQKNSHSKYSGVFIYKDLKSIEDTNNAITI
                    ************************************************************

    COL             ITIITAVIFLTITTVFAFFLSSRITKPLRRLRDQATRVSEGDYSYKPSVTTKDEIGQLSQ
    N315            ITIITAVIFLTITTVFAFFLSSRITKPLRRLRDQATRVSEGDYSYKPSVTTKDEIGQLSQ
    NCTC8325        ITIITAVIFLTITTVFAFFLSSRITKPLRRLRDQATRVSEGDYSYKPSVTTKDEIGQLSQ
    Newman          ITIITAVIFLTITTVFAFFLSSRITKPLRRLRDQATRVSEGDYSYKPSVTTKDEIGQLSQ
    USA300_FPR3757  ITIITAVIFLTITTVFAFFLSSRITKPLRRLRDQATRVSEGDYSYKPSVTTKDEIGQLSQ
                    ************************************************************

    COL             AFNQMSTEIEEHVDALSTSKNIRDSLINSMVEGVLGINESRQIILSNKMANDIMDNIDED
    N315            AFNQMSTEIEEHVDALSTSKNIRDSLINSMVEGVLGINESRQIILSNKMANDIMDNIDED
    NCTC8325        AFNQMSTEIEEHVDALSTSKNIRDSLINSMVEGVLGINESRQIILSNKMANDIMDNIDED
    Newman          AFNQMSTEIEEHVDALSTSKNIRDSLINSMVEGVLGINESRQIILSNKMANDIMDNIDED
    USA300_FPR3757  AFNQMSTEIEEHVDALSTSKNIRDSLINSMVEGVLGINESRQIILSNKMANDIMDNIDED
                    ************************************************************

    COL             AKAFLLRQIEDTFKSKQTEMRDLEMNARFFVVTTSYIDKIEQGGKSGVVVTVRDMTNEHN
    N315            AKAFLLRQIEDTFKSKQTEMRDLEMNARFFVVTTSYIDKIEQGGKSGVVVTVRDMTNEHN
    NCTC8325        AKAFLLRQIEDTFKSKQTEMRDLEMNARFFVVTTSYIDKIEQGGKSGVVVTVRDMTNEHN
    Newman          AKAFLLRQIEDTFKSKQTEMRDLEMNARFFVVTTSYIDKIEQGGKSGVVVTVRDMTNEHN
    USA300_FPR3757  AKAFLLRQIEDTFKSKQTEMRDLEMNARFFVVTTSYIDKIEQGGKSGVVVTVRDMTNEHN
                    ************************************************************

    COL             LDQMKKDFIANVSHELRTPISLLQGYTESIVDGIVTEPDEIKESLAIVLDESKRLNRLVN
    N315            LDQMKKDFIANVSHELRTPISLLQGYTESIVDGIVTEPDEIKESLAVVLDESKRLNRLVN
    NCTC8325        LDQMKKDFIANVSHELRTPISLLQGYTESIVDGIVTEPDEIKESLAIVLDESKRLNRLVN
    Newman          LDQMKKDFIANVSHELRTPISLLQGYTESIVDGIVTEPDEIKESLAIVLDESKRLNRLVN
    USA300_FPR3757  LDQMKKDFIANVSHELRTPISLLQGYTESIVDGIVTEPDEIKESLAIVLDESKRLNRLVN
                    **********************************************:*************

    COL             ELLNVARMDAEGLSVNKEVQPIAALLDKMKIKYRQQADDLGLNMTFNYCKKRVWSYDMDR
    N315            ELLNVARMDAEGLSVNKEVQPIAALLDKMKIKYRQQADDLGLNMTFNYCKKRVWSYDMDR
    NCTC8325        ELLNVARMDAEGLSVNKEVQPIAALLDKMKIKYRQQADDLGLNMTFNYCKKRVWSYDMDR
    Newman          ELLNVARMDAEGLSVNKEVQPIAALLDKMKIKYRQQADDLGLNMTFNYCKKRVWSYDMDR
    USA300_FPR3757  ELLNVARMDAEGLSVNKEVQPIAALLDKMKIKYRQQADDLGLNMTFNYCKKRVWSYDMDR
                    ************************************************************

    COL             MDQVLTNLIDNASRYTKPGDEIAITCDENESEDILYIKDTGTGIAPEHLQQVFDRFYKVD
    N315            MDQVLTNLIDNASRYTKPGDEIAITCDENESEDILYIKDTGTGIAPEHLQQVFDRFYKVD
    NCTC8325        MDQVLTNLIDNASRYTKPGDEIAITCDENESEDILYIKDTGTGIAPEHLQQVFDRFYKVD
    Newman          MDQVLTNLIDNASRYTKPGDEIAITCDENESEDILYIKDTGTGIAPEHLQQVFDRFYKVD
    USA300_FPR3757  MDQVLTNLIDNASRYTKPGDEIAITCDENESEDILYIKDTGTGIAPEHLQQVFDRFYKVD
                    ************************************************************

    COL             AARTRGKQGTGLGLFICKMIIEEHGGSIDVKSELGKGTTFIIKLPKPE
    N315            AARTRGKQGTGLGLFICKMIIEEHGGSIDVKSELGKGTTFIIKLPKPE
    NCTC8325        AARTRGKQGTGLGLFICKMIIEEHGGSIDVKSELGKGTTFIIKLPKPE
    Newman          AARTRGKQGTGLGLFICKMIIEEHGGSIDVKSELGKGTTFIIKLPKPE
    USA300_FPR3757  AARTRGKQGTGLGLFICKMIIEEHGGSIDVKSELGKGTTFIIKLPKPE
                    ************************************************