From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004037000
  • symbol?: rnz
  • description?: metallo-beta-lactamase

      descriptions from strain specific annotations:

    • metallo-beta-lactamase
    • ribonuclease Z
    • AtsA/ElaC family protein
    • metallo-beta-lactamase, AtsA/ElaC family
  • strand?: -
  • coordinates?: 4325409..4326329
  • synteny block?: BlockID0030740
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1461
    08BA02176:
    C248_1544
    11819-97:
    MS7_1521 (rnz)
    71193:
    ST398NM01_1570
    ECT-R 2:
    ECTR2_1355 (rnz)
    ED133:
    SAOV_1506
    ED98:
    SAAV_1494
    HO 5096 0412:
    SAEMRSA15_14260
    JH1:
    SaurJH1_1592
    JH9:
    SaurJH9_1561
    JKD6008:
    SAA6008_01473
    JKD6159:
    SAA6159_01433
    LGA251:
    SARLGA251_14120
    M013:
    M013TW_1518
    MRSA252:
    SAR1581
    MSHR1132:
    SAMSHR1132_13430
    MSSA476:
    SAS1444
    Mu3:
    SAHV_1492
    Mu50:
    SAV1504
    MW2:
    MW1458
    RF122:
    SAB1365c
    ST398:
    SAPIG1570 (rnz)
    T0131:
    SAT0131_01597
    TCH60:
    HMPREF0772_11637 (rnz)
    TW20:
    SATW20_15020
    USA300_TCH1516:
    USA300HOU_1505
    VC40:
    SAVC_06770

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEVTFFGTSAGLPTKERNTQAIALNLEPYSNSIWLFDVGEGTQHQILHHAIKLGKVTHIF
    N315            MEVTFFGTSAGLPTKERNTQAIALNLEPYSNSIWLFDVGEGTQHQILHHAIKLGKVTHIF
    NCTC8325        MEVTFFGTSAGLPTKERNTQAIALNLEPYSNSIWLFDVGEGTQHQILHHAIKLGKVTHIF
    Newman          MEVTFFGTSAGLPTKERNTQAIALNLEPYSNSIWLFDVGEGTQHQILHHAIKLGKVTHIF
    USA300_FPR3757  MEVTFFGTSAGLPTKERNTQAIALNLEPYSNSIWLFDVGEGTQHQILHHAIKLGKVTHIF
                    ************************************************************

    COL             ITHMHGDHIFGLPGLLSSRSFQGGEQKPLTLVGPKGIKAYVEMSMNLSESHLNYPITYIE
    N315            ITHMHGDHIFGLPGLLSSRSFQGGEQKPLTLVGPKGIKAYVEMSMNLSESHLNYPITYIE
    NCTC8325        ITHMHGDHIFGLPGLLSSRSFQGGEQKPLTLVGPKGIKAYVEMSMNLSESHLNYPITYIE
    Newman          ITHMHGDHIFGLPGLLSSRSFQGGEQKPLTLVGPKGIKAYVEMSMNLSESHLNYPITYIE
    USA300_FPR3757  ITHMHGDHIFGLPGLLSSRSFQGGEQKPLTLVGPKGIKAYVEMSMNLSESHLNYPITYIE
                    ************************************************************

    COL             IDDHLTYHHDGFTVEAHLLNHGIPSYGYRVMAPETTGTINVEALKNIGLEPGPKYQEVKS
    N315            IDDHLTYHHDGFTVEAHLLNHGIPSYGYRVMAPETTGTINVEALKNIGLEPGPKYQEVKS
    NCTC8325        IDDHLTYHHDGFTVEAHLLNHGIPSYGYRVMAPETTGTINVEALKNIGLEPGPKYQEVKS
    Newman          IDDHLTYHHDGFTVEAHLLNHGIPSYGYRVMAPETTGTINVEALKNIGLEPGPKYQEVKS
    USA300_FPR3757  IDDHLTYHHDGFTVEAHLLNHGIPSYGYRVMAPETTGTINVEALKNIGLEPGPKYQEVKS
                    ************************************************************

    COL             HDTFEHNGQVYQSKDFRGESKQGPVVAIFGDTKPCSNERVISRDADVMVHEATYIDGEKH
    N315            HDTFEHNGQVYQSKDFRGESKQGPVVAIFGDTKPCSNERVISRDADVMVHEATYIDGEKH
    NCTC8325        HDTFEHNGQVYQSKDFRGESKQGPVVAIFGDTKPCSNERVISRDADVMVHEATYIDGEKH
    Newman          HDTFEHNGQVYQSKDFRGESKQGPVVAIFGDTKPCSNERVISRDADVMVHEATYIDGEKH
    USA300_FPR3757  HDTFEHNGQVYQSKDFRGESKQGPVVAIFGDTKPCSNERVISRDADVMVHEATYIDGEKH
                    ************************************************************

    COL             LANNYHHSHIEDVFALIKEANVKRTLITHLSNRYNTEDINEIYQTLIQNEDTPNFNFVKD
    N315            LANNYHHSHIEDVFALIKEANVKRTLITHLSNRYNTEDINEIYQILIQNEDTPNFNFVKD
    NCTC8325        LANNYHHSHIEDVFALIKEANVKRTLITHLSNRYNTEDINEIYQTLIQNEDTPNFNFVKD
    Newman          LANNYHHSHIEDVFALIKEANVKRTLITHLSNRYNTEDINEIYQTLIQNEDTPNFNFVKD
    USA300_FPR3757  LANNYHHSHIEDVFALIKEANVKRTLITHLSNRYNTEDINEIYQTLIQNEDTPNFNFVKD
                    ******************************************** ***************

    COL             FDSFKI
    N315            FDSFKV
    NCTC8325        FDSFKI
    Newman          FDSFKI
    USA300_FPR3757  FDSFKI
                    *****: