From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004064000
  • symbol?:
  • description?: tripeptidase

      descriptions from strain specific annotations:

    • tripeptidase
    • peptidase T-like protein
    • M20/M25/M40 family peptidase
    • Peptidase T
    • peptidase family M20/M25/M40 family protein
    • peptidase M20/M25/M40 family protein
    • M20 family peptidase
    • putative peptidase
    • Tripeptidase T
  • strand?: -
  • coordinates?: 4347615..4348748
  • synteny block?: BlockID0030960
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1469
    08BA02176:
    C248_1553
    11819-97:
    MS7_1529
    71193:
    ST398NM01_1577
    ECT-R 2:
    ECTR2_1363
    ED133:
    SAOV_1513
    ED98:
    SAAV_1503
    HO 5096 0412:
    SAEMRSA15_14330
    JH1:
    SaurJH1_1602
    JH9:
    SaurJH9_1570
    JKD6008:
    SAA6008_01481
    JKD6159:
    SAA6159_01448
    LGA251:
    SARLGA251_14190
    M013:
    M013TW_1527
    MRSA252:
    SAR1590
    MSHR1132:
    SAMSHR1132_13520
    MSSA476:
    SAS1451
    Mu3:
    SAHV_1500
    Mu50:
    SAV1512
    MW2:
    MW1465
    RF122:
    SAB1385c
    ST398:
    SAPIG1577
    T0131:
    SAT0131_01605
    TCH60:
    HMPREF0772_11628
    TW20:
    SATW20_15090
    USA300_TCH1516:
    USA300HOU_1513
    VC40:
    SAVC_06805

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MINEQRLLNTFFELVQIDSETGNESTIQPILKEKFIALGLDVKEDEAAKHPKLGANNLVC
    N315            MINEQRLLNTFLELVQIDSETGNESTIQPILKEKFIALGLDVKEDEAAKHPKLGANNLVC
    NCTC8325        MINEQRLLNTFFELVQIDSETGNESTIQPILKEKFIALGLDVKEDEAAKHPKLGANNLVC
    Newman          MINEQRLLNTFFELVQIDSETGNESTIQPILKEKFIALGLDVKEDEAAKHPKLGANNLVC
    USA300_FPR3757  MINEQRLLNTFFELVQIDSETGNESTIQPILKEKFIALGLDVKEDEAAKHPKLGANNLVC
                    ***********:************************************************

    COL             TMNSTIEEGEVPKLYLTSHMDTVVPAINVKPIVKDDGYIYSDGTTILGADDKAGLAAMLE
    N315            TMNSTIEEGEVPKLYLTSHMDTVVPAINVKPIVKDDGYIYSDGTTILGADDKAGLAAMLE
    NCTC8325        TMNSTIEEGEVPKLYLTSHMDTVVPAINVKPIVKDDGYIYSDGTTILGADDKAGLSAMLE
    Newman          TMNSTIEEGEVPKLYLTSHMDTVVPAINVKPIVKDDGYIYSDGTTILGADDKAGLAAMLE
    USA300_FPR3757  TMNSTIEEGEVPKLYLTSHMDTVVPAINVKPIVKDDGYIYSDGTTILGADDKAGLAAMLE
                    *******************************************************:****

    COL             VLQVIKEQQIPHGQIQFVITVGEESGLIGAKELNSELLDADFGYAIDASADVGTTVVGAP
    N315            VLQVIKEQQIPHGQIQFVITVGEESGLIGAKELNSELLDADFGYAIDASADVGTTVVGAP
    NCTC8325        VLQVIKEQQIPHGQIQFVITVGEESGLIGAKELNSELLDADFGYAIDASADVGTTVVGAP
    Newman          VLQVIKEQQIPHGQIQFVITVGEESGLIGAKELNSELLDADFGYAIDASADVGTTVVGAP
    USA300_FPR3757  VLQVIKEQQIPHGQIQFVITVGEESGLIGAKELNSELLDADFGYAIDASADVGTTVVGAP
                    ************************************************************

    COL             TQMLISAKIFGKTAHASTPKEGVSAINIAAKAISRMKLGQVDEITTANIGKFHGGSATNI
    N315            TQMLISAKIIGKTAHASTPKEGVSAINIAAKAISRMKLGQVDEITTANIGKFHGGSATNI
    NCTC8325        TQMLISAKIFGKTAHASTPKEGVSAINIAAKAISRMKLGQVDEITTANIGKFHGGSATNI
    Newman          TQMLISAKIFGKTAHASTPKEGVSAINIAAKAISRMKLGQVDEITTANIGKFHGGSATNI
    USA300_FPR3757  TQMLISAKIFGKTAHASTPKEGVSAINIAAKAISRMKLGQVDEITTANIGKFHGGSATNI
                    *********:**************************************************

    COL             VADEVILEAEARSHDPERIKTQVKHMTDVFETTASELGGKAVVTVEQSYPGFKINDNEAV
    N315            VADEVILEAEARSHDPERIKTQVKHMTDVFETTASELGGKAEVTVEQSYPGFKINDNEAV
    NCTC8325        VADEVILEAEARSHDPERIKTQVKHMTDVFETTASELGGKAVVTVEQSYPGFKINDNEAV
    Newman          VADEVILEAEARSHDPERIKTQVKHMTDVFETTASELGGKAVVTVEQSYPGFKINDNEAV
    USA300_FPR3757  VADEVILEAEARSHDPERIKTQVKHMTDVFETTASELGGKAVVTVEQSYPGFKINDNEAV
                    ***************************************** ******************

    COL             VKIAQESARNLGLSANTIISGGGSDGSIINTFGIPSVILGVGYEKIHTTNERMPIKSLNL
    N315            VKIAQESARNLGLSANTIISGGGSDGSIINTFGIPSVILGVGYEKIHTTNERMPIKSLNL
    NCTC8325        VKIAQESARNLGLSANTIISGGGSDGSIINTFGIPSVILGVGYEKIHTTNERMPIKSLNL
    Newman          VKIAQESARNLGLSANTIISGGGSDGSIINTFGIPSVILGVGYEKIHTTNERMPIKSLNL
    USA300_FPR3757  VKIAQESARNLGLSANTIISGGGSDGSIINTFGIPSVILGVGYEKIHTTNERMPIKSLNL
                    ************************************************************

    COL             LASQVLEIIKIVARHSK
    N315            LASQVLEIIKIVARQSK
    NCTC8325        LASQVLEIIKIVARHSK
    Newman          LASQVLEIIKIVARHSK
    USA300_FPR3757  LASQVLEIIKIVARHSK
                    **************:**