From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004067000
  • symbol?:
  • description?: YqjA like protein

      descriptions from strain specific annotations:

    • YqjA like protein
    • integral membrane protein
    • conserved membrane protein YqjA
  • strand?: -
  • coordinates?: 4349343..4350323
  • synteny block?: BlockID0030990
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1471
    08BA02176:
    C248_1555
    11819-97:
    MS7_1531
    71193:
    ST398NM01_1579
    ECT-R 2:
    ECTR2_1365
    ED133:
    SAOV_1514
    ED98:
    SAAV_1505
    HO 5096 0412:
    SAEMRSA15_14340
    JH1:
    SaurJH1_1604
    JH9:
    SaurJH9_1572
    JKD6008:
    SAA6008_01483
    JKD6159:
    SAA6159_01449
    LGA251:
    SARLGA251_14200
    M013:
    M013TW_1529
    MRSA252:
    SAR1591
    MSHR1132:
    SAMSHR1132_13540
    MSSA476:
    SAS1452
    Mu3:
    SAHV_1501
    Mu50:
    SAV1513
    MW2:
    MW1466
    RF122:
    SAB1386c
    ST398:
    SAPIG1579
    T0131:
    SAT0131_01607
    TCH60:
    HMPREF0772_11627
    TW20:
    SATW20_15100
    USA300_TCH1516:
    USA300HOU_1515
    VC40:
    SAVC_06815

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLKLNPYKIGFRTIKTAVGMTLGVIISKLLGLDNYASSAILVVLCIKHTKVHSLQAIISR
    N315            MLKLNPYKIGFRTIKTAVGMTLGVIISKLLGLDNYASSAILVVLCIKHTKVHSLQAIISR
    NCTC8325        MLKLNPYKIGFRTIKTAVGMTLGVIISKLLGLDNYASSAILVVLCIKHTKVHSLQAIISR
    Newman          MLKLNPYKIGFRTIKTAVGMTLGVIISKLLGLDNYASSAILVVLCIKHTKVHSLQAIISR
    USA300_FPR3757  MLKLNPYKIGFRTIKTAVGMTLGVIISKLLGLDNYASSAILVVLCIKHTKVHSLQAIISR
                    ************************************************************

    COL             LVSCFLVLFLGSAIFSLLGQSPIVLGIIVLLFIPLTVVLKVQEGVITSCVILLHVFNAKS
    N315            LVSCFLVLFLGSAIFSLLGQSPIVLGIIVLLFIPLTVVLKVQEGVITSCVILLHVFNAKS
    NCTC8325        LVSCFLVLFLGSAIFSLLGQSPIVLGIIVLLFIPLTVVLKVQEGVITSCVILLHVFNAKS
    Newman          LVSCFLVLFLGSAIFSLLGQSPIVLGIIVLLFIPLTVVLKVQEGVITSCVILLHVFNAKS
    USA300_FPR3757  LVSCFLVLFLGSAIFSLLGQSPIVLGIIVLLFIPLTVVLKVQEGVITSCVILLHVFNAKS
                    ************************************************************

    COL             IDAHLIVNETLLLLIGLSIAFTMNLMMPSLDKQLDEYKCKIEQQIADIFSKYSYICEKYE
    N315            IDAHLIVNETLLLLIGLSIAFTMNLMMPSLDKQLDEYKCKIEQQIADIFSKYSYICEKYE
    NCTC8325        IDAHLIVNETLLLLIGLSIAFTMNLMMPSLDKQLDEYKCKIEQQIADIFSKYSYICEKYE
    Newman          IDAHLIVNETLLLLIGLSIAFTMNLMMPSLDKQLDEYKCKIEQQIADIFSKYSYICEKYE
    USA300_FPR3757  IDAHLIVNETLLLLIGLSIAFTMNLMMPSLDKQLDEYKCKIEQQIADIFSKYSYICEKYE
                    ************************************************************

    COL             DTIAIEFEVLLLNIKKAKSIAFRDVKNHFVRNENSYYHYFDMREEQVELLMRMKPLIESI
    N315            DTIAIEFEVLLLNIKKAKSIAFRDVKNHFVRNENSYYHYFDMREEQVELLMRMKPLIESI
    NCTC8325        DTIAIEFEVLLLNIKKAKSIAFRDVKNHFVRNENSYYHYFDMREEQVELLMRMKPLIESI
    Newman          DTIAIEFEVLLLNIKKAKSIAFRDVKNHFVRNENSYYHYFDMREEQVELLMRMKPLIESI
    USA300_FPR3757  DTIAIEFEVLLLNIKKAKSIAFRDVKNHFVRNENSYYHYFDMREEQVELLMRMKPLIESI
                    ************************************************************

    COL             CHKDPLLNDVASLLKEIGLNVNSNDYTAMRLHNLYETRLKLDELPLPTTHKALNSRASII
    N315            CHKDPLLNDVSSLLKEIGLNVNSNDYTAMRLHNLYETRLKLDELPLPTTHKALNSRASII
    NCTC8325        CHKDPLLNDVASLLKEIGLNVNSNDYTAMRLHNLYETRLKLDELPLPTTHKALNSRASII
    Newman          CHKDPLLNDVASLLKEIGLNVNSNDYTAMRLHNLYETRLKLDELPLPTTHKALNSRASII
    USA300_FPR3757  CHKDPLLNDVASLLKEIGLNVNSNDYTAMRLHNLYETRLKLDELPLPTTHKALNSRASII
                    **********:*************************************************

    COL             QILNELEEYLQIKSQFGSLKMHSEVA
    N315            QILNELEEYLQIKSQFGSLKMHSEVA
    NCTC8325        QILNELEEYLQIKSQFGSLKMHSEVA
    Newman          QILNELEEYLQIKSQFGSLKMHSEVA
    USA300_FPR3757  QILNELEEYLQIKSQFGSLKMHSEVA
                    **************************