From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004070000
  • symbol?: bmfBB
  • description?: 2-oxoglutarate dehydrogenase E2

      descriptions from strain specific annotations:

    • 2-oxoglutarate dehydrogenase E2
    • 2-oxoisovalerate dehydrogenase, E2 component, dihydrolipoamide acetyltransferase
    • branched-chain alpha-keto acid dehydrogenase E2 subunit
    • 2-oxoisovalerate dehydrogenase, E2 component
    • 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase
    • branched-chain alpha-keto aciddehydrogenase complex lipoamide acyltransferase subunit
    • dehydrogenase catalytic domain-containing protein
    • dihydrolipoamide acyltransferase
    • Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex
    • dihydrolipoyllysine-residue acetyltransferase
    • lipoamide acyltransferase component ofbranched-chain alpha-keto acid dehydrogenase complex
    • lipoamide acyltransferase component of branched-chain alpha-keto aciddehydrogenase complex (Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase) (E2) (Dihydrolipoamide branched chaintransacylase)
  • strand?: -
  • coordinates?: 4351157..4352445
  • synteny block?: BlockID0031020
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1346 (bmfBB)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1474 (bmfBB)
    08BA02176:
    C248_1558 (bfmB)
    11819-97:
    MS7_1533
    71193:
    ST398NM01_1581
    ECT-R 2:
    ECTR2_1367
    ED133:
    SAOV_1516
    ED98:
    SAAV_1508
    HO 5096 0412:
    SAEMRSA15_14360 (bfmB)
    JH1:
    SaurJH1_1607
    JH9:
    SaurJH9_1574
    JKD6008:
    SAA6008_01485 (bfmB)
    JKD6159:
    SAA6159_01451 (bfmB)
    LGA251:
    SARLGA251_14220 (bfmB)
    M013:
    M013TW_1531
    MRSA252:
    SAR1593 (bfmB)
    MSHR1132:
    SAMSHR1132_13560
    MSSA476:
    SAS1454
    Mu3:
    SAHV_1503 (bmfBB)
    Mu50:
    SAV1515 (bmfBB)
    MW2:
    MW1468 (bmfBB)
    RF122:
    SAB1388c
    ST398:
    SAPIG1581
    T0131:
    SAT0131_01609
    TCH60:
    HMPREF0772_11625 (bkdC)
    TW20:
    SATW20_15120 (bfmB)
    USA300_TCH1516:
    USA300HOU_1517 (bmfBB)
    VC40:
    SAVC_06825

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEITMPKLGESVHEGTIEQWLVSVGDHIDEYEPLCEVITDKVTAEVPSTISGTITEILVE
    N315            MEITMPKLGESVHEGTIEQWLVSVGDHIDEYEPLCEVITDKVTAEVPSTISGTITEILVE
    NCTC8325        MEITMPKLGESVHEGTIEQWLVSVGDHIDEYEPLCEVITDKVTAEVPSTISGTITEILVE
    Newman          MEITMPKLGESVHEGTIEQWLVSVGDHIDEYEPLCEVITDKVTAEVPSTISGTITEILVE
    USA300_FPR3757  MEITMPKLGESVHEGTIEQWLVSVGDHIDEYEPLCEVITDKVTAEVPSTISGTITEILVE
                    ************************************************************

    COL             AGQTVAIDTIICKIETADEKTNETTEEIQAKVDEHTQKSTKKASATVEQTSTAKQNQPRN
    N315            AGQTVAIDTIICKIETADEKTNETTEEIQAKVDEHTQKSTKKASATVEQTFTAKQNQPRN
    NCTC8325        AGQTVAIDTIICKIETADEKTNETTEEIQAKVDEHTQKSTKKASATVEQTSTAKQNQPRN
    Newman          AGQTVAIDTIICKIETADEKTNETTEEIQAKVDEHTQKSTKKASATVEQTSTAKQNQPRN
    USA300_FPR3757  AGQTVAIDTIICKIETADEKTNETTEEIQAKVDEHTQKSTKKASATVEQTSTAKQNQPRN
                    ************************************************** *********

    COL             NGRFSPVVFKLASEHDIDLSQVVGSGFEGRVTKKDIMSVIENGGTTAQSDKQVQTKSTSV
    N315            NGRFSPVVFKLASEHDIDLSQVVGSGFEGRVTKKDIMSVIENGGTTAQSDKQVQTKSTSV
    NCTC8325        NGRFSPVVFKLASEHDIDLSQVVGSGFEGRVTKKDIMSVIENGGTTAQSDKQVQTKSTSV
    Newman          NGRFSPVVFKLASEHDIDLSQVVGSGFEGRVTKKDIMSVIENGGTTAQSDKQVQTKSTSV
    USA300_FPR3757  NGRFSPVVFKLASEHDIDLSQVVGSGFEGRVTKKDIMSVIENGGTTAQSDKQVQTKSTSV
                    ************************************************************

    COL             DTSSNQSSEDNSENSTIPVNGVRKAIAQNMVNSVTEIPHAWMMIEVDATNLVKTRNHYKN
    N315            DTSSNQSSEDNSENSTIPVNGVRKAIAQNMVNSVTEIPHAWMMIEVDATNLVNTRNHYKN
    NCTC8325        DTSSNQSSEDNSENSTIPVNGVRKAIAQNMVNSVTEIPHAWMMIEVDATNLVNTRNHYKN
    Newman          DTSSNQSSEDNSENSTIPVNGVRKAIAQNMVNSVTEIPHAWMMIEVDATNLVNTRNHYKN
    USA300_FPR3757  DTSSNQSSEDNSENSTIPVNGVRKAIAQNMVNSVTEIPHAWMMIEVDATNLVNTRNHYKN
                    ****************************************************:*******

    COL             SFKNKEGYNLTFFAFFVKAVADALKAYPLLNSSWQGNEIVLHKDINISIAVADENKLYVP
    N315            SFKNKEGYNLTFFAFFVKAVADALKAYPLLNSSWQGNEIVLHKDINISIAVADENKLYVP
    NCTC8325        SFKNKEGYNLTFFAFFVKAVADALKAYPLLNSSWQGNEIVLHKDINISIAVADENKLYVP
    Newman          SFKNKEGYNLTFFAFFVKAVADALKAYPLLNSSWQGNEIVLHKDINISIAVADENKLYVP
    USA300_FPR3757  SFKNKEGYNLTFFAFFVKAVADALKAYPLLNSSWQGNEIVLHKDINISIAVADENKLYVP
                    ************************************************************

    COL             VIKHADEKSIKGIAREINTLATKARNKQLTAEDMQGGTFTVNNTGTFGSVSSMGIINHPQ
    N315            VIKHADEKSIKGIAREINTLATKARNKQLTTEDMQGGTFTVNNTGTFGSVSSMGIINHPQ
    NCTC8325        VIKHADEKSIKGIAREINTLATKARNKQLTAEDMQGGTFTVNNTGTFGSVSSMGIINHPQ
    Newman          VIKHADEKSIKGIAREINTLATKARNKQLTAEDMQGGTFTVNNTGTFGSVSSMGIINHPQ
    USA300_FPR3757  VIKHADEKSIKGIAREINTLATKARNKQLTAEDMQGGTFTVNNTGTFGSVSSMGIINHPQ
                    ******************************:*****************************

    COL             AAILQVESIVKKPVVINDMIAIRNMVNLCISIDHRILDGLQTGKFMNHIKQRIEQYTLEN
    N315            AAILQVESIVKKPVVINDMIAIRSMVNLCISIDHRILDGLQTGKFMNHIKQRIEQYTLEN
    NCTC8325        AAILQVESIVKKPVVINDMIAIRNMVNLCISIDHRILDGLQTGKFMNHIKQRIEQYTLEN
    Newman          AAILQVESIVKKPVVINDMIAIRNMVNLCISIDHRILDGLQTGKFMNHIKQRIEQYTLEN
    USA300_FPR3757  AAILQVESIIKKPVVINDMIAIRNMVNLCISIDHRILDGLQTGKFMNHIKQRIEQYTLEN
                    *********:*************.************************************

    COL             TNIY
    N315            TNIY
    NCTC8325        TNIY
    Newman          TNIY
    USA300_FPR3757  TNIY
                    ****