From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004072000
  • symbol?: bfmBAA
  • description?: branched-chain alpha-keto acid dehydrogenase E1

      descriptions from strain specific annotations:

    • branched-chain alpha-keto acid dehydrogenase E1
    • 2-oxoisovalerate dehydrogenase subunit alpha
    • 3-methyl-2-oxobutanoate dehydrogenase
    • 2-oxoisovalerate dehydrogenase, E1 component, alpha subunit
    • Branched-chain alpha-keto acid dehydrogenase, E1 component, alpha subunit
    • 2-oxoisovalerate dehydrogenase, E1 component subunit alpha
    • pyruvate dehydrogenase (acetyl-transferring) alpha subunit
    • 2-oxoisovalerate dehydrogenase E1 subunit alpha
    • 2-oxoisovalerate dehydrogenase alpha subunit
    • 2-oxoisovalerate dehydrogenase subunit alpha (branched-chain alpha-keto acid dehydrogenase e1 component alpha chain) (bckdhe1-alpha)
  • strand?: -
  • coordinates?: 4353434..4354433
  • synteny block?: BlockID0031040
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1348 (bfmBAA)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1476 (bfmBAA)
    08BA02176:
    C248_1560 (bfmBAA)
    11819-97:
    MS7_1535 (bfmBAA)
    71193:
    ST398NM01_1583
    ECT-R 2:
    ECTR2_1369
    ED133:
    SAOV_1518
    ED98:
    SAAV_1510
    HO 5096 0412:
    SAEMRSA15_14380 (bfmBAA)
    JH1:
    SaurJH1_1609
    JH9:
    SaurJH9_1576
    JKD6008:
    SAA6008_01487 (acoA)
    JKD6159:
    SAA6159_01453 (acoA)
    LGA251:
    SARLGA251_14240 (bfmBAA)
    M013:
    M013TW_1533
    MRSA252:
    SAR1595 (bfmBAA)
    MSHR1132:
    SAMSHR1132_13580
    MSSA476:
    SAS1456
    Mu3:
    SAHV_1505 (bfmBAA)
    Mu50:
    SAV1517 (bfmBAA)
    MW2:
    MW1470 (bfmBAA)
    RF122:
    SAB1390c
    ST398:
    SAPIG1583
    T0131:
    SAT0131_01611
    TCH60:
    HMPREF0772_11623 (bkdA)
    TW20:
    SATW20_15140 (bfmBAA)
    USA300_TCH1516:
    USA300HOU_1519 (odpA)
    VC40:
    SAVC_06835

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIDYKSLGLSEEDLKVIYKWMDLGRKIDERLWLLNRAGKIPFVVSGQGQEATQIGMAYAL
    N315            MIDYKSLGLSEEDLKVIYKWMDLGRKIDERLWLLNRAGKIPFVVSGQGQEATQIGMAYAL
    NCTC8325        MIDYKSLGLSEEDLKVIYKWMDLGRKIDERLWLLNRAGKIPFVVSGQGQEATQIGMAYAL
    Newman          MIDYKSLGLSEEDLKVIYKWMDLGRKIDERLWLLNRAGKIPFVVSGQGQEATQIGMAYAL
    USA300_FPR3757  MIDYKSLGLSEEDLKVIYKWMDLGRKIDERLWLLNRAGKIPFVVSGQGQEATQIGMAYAL
                    ************************************************************

    COL             EEGDITAPYYRDLAFVTYMGISAYDTFLSAFGKKDDVNSGGKQMPSHFSSRAKNILSQSS
    N315            EEGDITAPYYRDLAFVTYMGISAYDTFLSAFGKKDDVNSGGKQMPSHFSSRAKNILSQSS
    NCTC8325        EEGDITAPYYRDLAFVTYMGISAYDTFLSAFGKKDDVNSGGKQMPSHFSSRAKNILSQSS
    Newman          EEGDITAPYYRDLAFVTYMGISAYDTFLSAFGKKDDVNSGGKQMPSHFSSRAKNILSQSS
    USA300_FPR3757  EEGDITAPYYRDLAFVTYMGISAYDTFLSAFGKKDDVNSGGKQMPSHFSSRAKNILSQSS
                    ************************************************************

    COL             PVATQIPHAVGAALALKMDGKKKIATATVGEGSSNQGDFHEGLNFAGVHKLPFVCVIINN
    N315            PVATQIPHAVGAALALKMDGKKKIATATVGEGSSNQGDFHEGLNFAGVHKLPFVCVIINN
    NCTC8325        PVATQIPHAVGAALALKMDGKKKIATATVGEGSSNQGDFHEGLNFAGVHKLPFVCVIINN
    Newman          PVATQIPHAVGAALALKMDGKKKIATATVGEGSSNQGDFHEGLNFAGVHKLPFVCVIINN
    USA300_FPR3757  PVATQIPHAVGAALALKMDGKKKIATATVGEGSSNQGDFHEGLNFAGVHKLPFVCVIINN
                    ************************************************************

    COL             KYAISVPDSLQYAAEKLSDRALGYGIHGEQVDGNDPLAMYKAMKEARDRAISGQGSTLIE
    N315            KYAISVPDSLQYAAEKLSDRALGYGIHGEQVDGNDPLAMYKAMKEARDRAISGQGSTLIE
    NCTC8325        KYAISVPDSLQYAAEKLSDRALGYGIHGEQVDGNDPLAMYKAMKEARDRAISGQGSTLIE
    Newman          KYAISVPDSLQYAAEKLSDRALGYGIHGEQVDGNDPLAMYKAMKEARDRAISGQGSTLIE
    USA300_FPR3757  KYAISVPDSLQYAAEKLSDRALGYGIHGEQVDGNDPLAMYKAMKEARDRAISGQGSTLIE
                    ************************************************************

    COL             AVTSRMTAHSSDDDDQYRTKEERETLKKADCNEKFKKELLSAGIIDDAWLAEIEAEHKDI
    N315            AVTSRMTAHSSDDDDQYRTKEEREALKKADCNEKFKKELLSAGIIDDAWLAEIEAEHKDI
    NCTC8325        AVTSRMTAHSSDDDDQYRTKEERETLKKADCNEKFKKELLSAGIIDDAWLAEIEAEHKDI
    Newman          AVTSRMTAHSSDDDDQYRTKEERETLKKADCNEKFKKELLSAGIIDDAWLAEIEAEHKDI
    USA300_FPR3757  AVTSRMTAHSSDDDDQYRTKEERETLKKADCNEKFKKELLSAGIIDDAWLAEIEAEHKDI
                    ************************:***********************************

    COL             INKATKAAEDAPYPSVEEAYAFVYEEGSLN
    N315            INKATKAAEDAPYPSVEEAYAFVYEEGSLN
    NCTC8325        INKATKAAEDAPYPSVEEAYAFVYEEGSLN
    Newman          INKATKAAEDAPYPSVEEAYAFVYEEGSLN
    USA300_FPR3757  INKATKAAEDAPYPSVEEAYAFVYEEGSLN
                    ******************************