From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004076000
  • symbol?: ispA
  • description?: geranyltranstransferase

      descriptions from strain specific annotations:

    • geranyltranstransferase
    • Geranyltranstransferase (farnesyldiphosphate synthase)
    • dimethylallyltransferase
    • geranyltranstransferase (Farnesyl-diphosphate synthase)(FPP synthase)
    • geranyltranstransferase-like protein
    • ispA protein
    • polyprenyl synthetase
    • putative geranyltranstransferase
  • strand?: -
  • coordinates?: 4358607..4359473
  • synteny block?: BlockID0031080
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1566 (ispA)
    N315:
    SA1352 (ispA)
    NCTC8325:
    Newman:
    NWMN_1427 (ispA)
    USA300_FPR3757:
    04-02981:
    SA2981_1480 (ispA)
    08BA02176:
    C248_1564
    11819-97:
    MS7_1539 (ispA)
    71193:
    ST398NM01_1587
    ECT-R 2:
    ECTR2_1373
    ED133:
    SAOV_1522 (ispA)
    ED98:
    SAAV_1514 (ispA)
    HO 5096 0412:
    SAEMRSA15_14420
    JH1:
    SaurJH1_1613
    JH9:
    SaurJH9_1580
    JKD6008:
    SAA6008_01491 (ispA)
    JKD6159:
    SAA6159_01457 (ispA)
    LGA251:
    SARLGA251_14280
    M013:
    M013TW_1537
    MRSA252:
    SAR1599
    MSHR1132:
    SAMSHR1132_13620
    MSSA476:
    SAS1460
    Mu3:
    SAHV_1509 (ispA)
    Mu50:
    SAV1521 (ispA)
    MW2:
    MW1474 (ispA)
    RF122:
    SAB1394c
    ST398:
    SAPIG1587
    T0131:
    SAT0131_01615 (gltC)
    TCH60:
    HMPREF0772_11619 (ispA)
    TW20:
    SATW20_15180
    USA300_TCH1516:
    USA300HOU_1523 (ispA)
    VC40:
    SAVC_06855

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTNLPMNKLIDEVNNELSVAINKSVMDTQLEESMLYSLNAGGKRIRPVLLLLTLDSLNTE
    N315            MTNLPMNKLIDEVNNELSVAINKSVMDTQLEESMLYSLNAGGKRIRPVLLLLTLDSLNTE
    NCTC8325        MTNLPMNKLIDEVNNELSVAINKSVMDTQLEESMLYSLNAGGKRIRPVLLLLTLDSLNTE
    Newman          MTNLPMNKLIDEVNNELSVAINKSVMDTQLEESMLYSLNAGGKRIRPVLLLLTLDSLNTE
    USA300_FPR3757  MTNLPMNKLIDEVNNELSVAINKSVMDTQLEESMLYSLNAGGKRIRPVLLLLTLDSLNTE
                    ************************************************************

    COL             YELGMKSAIALEMIHTYSLIHDDLPAMDNDDYRRGKLTNHKVYGEWTAILAGDALLTKAF
    N315            YELGVKSAIALEMIHTYSLIHDDLPAMDNDDYRRGKLTNHKVYGEWTAILAGDALLTKAF
    NCTC8325        YELGMKSAIALEMIHTYSLIHDDLPAMDNDDYRRGKLTNHKVYGEWTAILAGDALLTKAF
    Newman          YELGMKSAIALEMIHTYSLIHDDLPAMDNDDYRRGKLTNHKVYGEWTAILAGDALLTKAF
    USA300_FPR3757  YELGMKSAIALEMIHTYSLIHDDLPAMDNDDYRRGKLTNHKVYGEWTAILAGDALLTKAF
                    ****:*******************************************************

    COL             ELISSDDRLTDEVKIKVLQRLSIASGHVGMVGGQMLDMQSEGQPIDLETLEMIHKTKTGA
    N315            ELISSDDRLTDEVKIKVLQRLSIASGHVGMVGGQMLDMQSEGQPIDLETLEMIHKTKTGA
    NCTC8325        ELISSDDRLTDEVKIKVLQRLSIASGHVGMVGGQMLDMQSEGQPIDLETLEMIHKTKTGA
    Newman          ELISSDDRLTDEVKIKVLQRLSIASGHVGMVGGQMLDMQSEGQPIDLETLEMIHKTKTGA
    USA300_FPR3757  ELISSDDRLTDEVKIKVLQRLSIASGHVGMVGGQMLDMQSEGQPIDLETLEMIHKTKTGA
                    ************************************************************

    COL             LLTFAVMSAADIANVDDTTKEHLESYSYHLGMMFQIKDDLLDCYGDEAKLGKKVGSDLEN
    N315            LLTFAVMSAADIANVDDATKEHLESYSYHLGMMFQIKDDLLDCYGDEAKLGKKVGSDLEN
    NCTC8325        LLTFAVMSAADIANVDDTTKEHLESYSYHLGMMFQIKDDLLDCYGDEAKLGKKVGSDLEN
    Newman          LLTFAVMSAADIANVDDTTKEHLESYSYHLGMMFQIKDDLLDCYGDEAKLGKKVGSDLEN
    USA300_FPR3757  LLTFAVMSAADIANVDDTTKEHLESYSYHLGMMFQIKDDLLDCYGDEAKLGKKVGSDLEN
                    *****************:******************************************

    COL             NKSTYVSLLGKDGAEDKLTYHRDAAVDELTQIDEQFNTKHLLEIVDLFYSRDH
    N315            NKSTYVSLLGKDGAEDKLTYHRDAAVDELTQIDEQFNTKHLLEIVDLFYSRDH
    NCTC8325        NKSTYVSLLGKDGAEDKLTYHRDAAVDELTQIDEQFNTKHLLEIVDLFYSRDH
    Newman          NKSTYVSLLGKDGAEDKLTYHRDAAVDELTQIDEQFNTKHLLEIVDLFYSRDH
    USA300_FPR3757  NKSTYVSLLGKDGAEDKLTYHRDAAVDELTQIDEQFNTKHLLEIVDLFYSRDH
                    *****************************************************