From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004114000
  • symbol?: gcvT
  • description?: glycine cleavage system aminomethyltransferase T

      descriptions from strain specific annotations:

    • glycine cleavage system aminomethyltransferase T
    • Aminomethyltransferase (glycine cleavage system T protein)
    • putative aminomethyltransferase
  • strand?: -
  • coordinates?: 4390417..4391508
  • synteny block?: BlockID0031440
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1595 (gcvT)
    N315:
    SA1367 (gcvT)
    NCTC8325:
    Newman:
    NWMN_1441 (gcvT)
    USA300_FPR3757:
    04-02981:
    SA2981_1495
    08BA02176:
    C248_1579 (gcvT)
    11819-97:
    MS7_1554 (gcvT)
    71193:
    ST398NM01_1602
    ECT-R 2:
    ECTR2_1388 (gcvT)
    ED133:
    SAOV_1537 (gcvT)
    ED98:
    SAAV_1529 (gcvT)
    HO 5096 0412:
    SAEMRSA15_14570 (gcvT)
    JH1:
    SaurJH1_1628 (gcvT)
    JH9:
    SaurJH9_1595 (gcvT)
    JKD6008:
    SAA6008_01506 (gcvT)
    JKD6159:
    SAA6159_01472 (gcvT)
    LGA251:
    SARLGA251_14430 (gcvT)
    M013:
    M013TW_1552
    MRSA252:
    SAR1614 (gcvT)
    MSHR1132:
    SAMSHR1132_13770
    MSSA476:
    SAS1475 (gcvT)
    Mu3:
    SAHV_1524 (gcvT)
    Mu50:
    SAV1537 (gcvT)
    MW2:
    MW1489 (gcvT)
    RF122:
    SAB1409c (gcvT)
    ST398:
    SAPIG1602 (gcvT)
    T0131:
    SAT0131_01630
    TCH60:
    HMPREF0772_11604 (gcvT)
    TW20:
    SATW20_15330 (gcvT)
    USA300_TCH1516:
    USA300HOU_1538 (gcvT)
    VC40:
    SAVC_06930 (gcvT)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSSDLKQTPLYQNYVDRGAKIVEFGGWAMPVQFSSIKEEHNAVRYEIGLFDVSHMGEIEV
    N315            MSSDLKQTPLYQNYVDRGAKIVEFGGWAMPVQFSSIKEEHNAVRYEIGLFDVSHMGEIEV
    NCTC8325        MSSDLKQTPLYQNYVDRGAKIVEFGGWAMPVQFSSIKEEHNAVRYEIGLFDVSHMGEIEV
    Newman          MSSDLKQTPLYQNYVDRGAKIVEFGGWAMPVQFSSIKEEHNAVRYEIGLFDVSHMGEIEV
    USA300_FPR3757  MSSDLKQTPLYQNYVDRGAKIVEFGGWAMPVQFSSIKEEHNAVRYEIGLFDVSHMGEIEV
                    ************************************************************

    COL             TGKDASQFVQYLLSNDTDNLTTSKALYTALCNEEGGIIDDLVIYKLADDNYLLVVNAANT
    N315            TGKDASQFVQYLLSNDTDNLTTSKALYTALCNEEGGIIDDLVIYKLADDNYLLVVNAANT
    NCTC8325        TGKDASQFVQYLLSNDTDNLTTSKALYTALCNEEGGIIDDLVIYKLADDNYLLVVNAANT
    Newman          TGKDASQFVQYLLSNDTDNLTTSKALYTALCNEEGGIIDDLVIYKLADDNYLLVVNAANT
    USA300_FPR3757  TGKDASQFVQYLLSNDTDNLTTSKALYTALCNEEGGIIDDLVIYKLADDNYLLVVNAANT
                    ************************************************************

    COL             EKDFNWILKHKEKFDVEVQNVSNQYGQLAIQGPKARDLINQLVDEDVTEMKMFEFKQGVK
    N315            EKDFNWILKHKEKFDVEVQNVSNQYGQLAIQGPKARDLINQLVDEDVTEMKMFEFKQGVK
    NCTC8325        EKDFNWILKHKEKFDVEVQNVSNQYGQLAIQGPKARDLINQLVDEDVTEMKMFEFKQGVK
    Newman          EKDFNWILKHKEKFDVEVQNVSNQYGQLAIQGPKARDLINQLVDEDVTEMKMFEFKQGVK
    USA300_FPR3757  EKDFNWILKHKEKFDVEVQNVSNQYGQLAIQGPKARDLINQLVDEDVTEMKMFEFKQGVK
                    ************************************************************

    COL             LFGANVILSQSGYTGEDGFEIYCNIDDTEKIWDGLLEYNVMPCGLGARDTLRLEAGLPLH
    N315            LFGANVILSQSGYTGEDGFEIYCNIDDTEKIWDGLLEYNVMPCGLGARDTLRLEAGLPLH
    NCTC8325        LFGANVILSQSGYTGEDGFEIYCNIDDTEKIWDGLLEYNVMPCGLGARDTLRLEAGLPLH
    Newman          LFGANVILSQSGYTGEDGFEIYCNIDDTEKIWDGLLEYNVMPCGLGARDTLRLEAGLPLH
    USA300_FPR3757  LFGANVILSQSGYTGEDGFEIYCNIDDTEKIWDGLLEYNVMPCGLGARDTLRLEAGLPLH
                    ************************************************************

    COL             GQDLTESITPYEGGIAFASKPLIDADFIGKSVLKDQKENGAPRRTVGLELLEKGIARTGY
    N315            GQDLTESITPYEGGIAFASKPLIDADFIGKSVLKDQKENGAPRRTVGLELLEKGIARTGY
    NCTC8325        GQDLTESITPYEGGIAFASKPLIDADFIGKSVLKDQKENGAPRRTVGLELLEKGIARTGY
    Newman          GQDLTESITPYEGGIAFASKPLIDADFIGKSVLKDQKENGAPRRTVGLELLEKGIARTGY
    USA300_FPR3757  GQDLTESITPYEGGIAFASKPLIDADFIGKSVLKDQKENGAPRRTVGLELLEKGIARTGY
                    ************************************************************

    COL             EVMDLDGNIIGEVTSGTQSPSSGKSIALAMIKRDEFEMGRELLVQVRKRQLKAKIVKKNQ
    N315            EVMDLDGNIIGEVTSGTQSPSSGKSIALAMIKRDEFEMGRELLVQVRKRQLKAKIVKKNQ
    NCTC8325        EVMDLDGNIIGEVTSGTQSPSSGKSIALAMIKRDEFEMGRELLVQVRKRQLKAKIVKKNQ
    Newman          EVMDLDGNIIGEVTSGTQSPSSGKSIALAMIKRDEFEMGRELLVQVRKRQLKAKIVKKNQ
    USA300_FPR3757  EVMDLDGNIIGEVTSGTQSPSSGKSIALAMIKRDEFEMGRELLVQVRKRQLKAKIVKKNQ
                    ************************************************************

    COL             IDK
    N315            IDK
    NCTC8325        IDK
    Newman          IDK
    USA300_FPR3757  IDK
                    ***