From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004118000
  • symbol?: comGF
  • description?: Late competence protein ComGF, access of DNA to ComEA

      descriptions from strain specific annotations:

    • Late competence protein ComGF, access of DNA to ComEA
    • competence ComGF-like protein
    • membrane associated protein
    • Late competence protein, putative
    • Competence protein ComGF-like protein
  • strand?: -
  • coordinates?: 4392432..4392808
  • synteny block?: BlockID0031480
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1497 (comGF)
    08BA02176:
    C248_1582
    11819-97:
    MS7_1556 (comGF)
    71193:
    ST398NM01_1604
    ECT-R 2:
    ECTR2_1390
    ED133:
    SAOV_1539
    ED98:
    SAAV_1532
    HO 5096 0412:
    SAEMRSA15_14590
    JH1:
    SaurJH1_1631
    JH9:
    SaurJH9_1597
    JKD6008:
    SAA6008_01509 (comGF)
    JKD6159:
    SAA6159_01474 (comGF)
    LGA251:
    SARLGA251_14450
    M013:
    M013TW_1554
    MRSA252:
    SAR1616
    MSHR1132:
    SAMSHR1132_13800
    MSSA476:
    SAS1477
    Mu3:
    SAHV_1526
    Mu50:
    SAV1539
    MW2:
    MW1491
    RF122:
    SAB1411c
    ST398:
    SAPIG1604
    T0131:
    SAT0131_01633
    TCH60:
    HMPREF0772_11602 (comGF)
    TW20:
    SATW20_15350
    USA300_TCH1516:
    USA300HOU_1541
    VC40:
    SAVC_06940

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MILSKVTNKFVLFQKIPLLIKRHVYSINVKAFSLIEMLVAMMVISITLLIVPDLIRLSKT
    N315            MILSKVTNKFVLFQKIPLLIKRHVYSINVKAFSLIEMLVAMMVISIILLIVPDLIRLSKT
    NCTC8325        MILSKVTNKFVLFQKIPLLIKRHVYSINVKAFSLIEMLVAMMVISITLLIVPDLIRLSKT
    Newman          MILSKVTNKFVLFQKIPLLIKRHVYSINVKAFSLIEMLVAMMVISITLLIVPDLIRLSKT
    USA300_FPR3757  MILSKVTNKFVLFQKIPLLIKRHVYSINVKAFSLIEMLVAMMVISITLLIVPDLIRLSKT
                    ********************************************** *************

    COL             FLIESRDLTTVDFEFFSRDILDDFKGVDRNDIEIRQHRIILHKGEEMIEYKLINNKIIKV
    N315            FLIESRELTTVDFEFFSRDILEDFKGVDKNDIEIRQQRIILHKGEEMIEYKLINNKIIKV
    NCTC8325        FLIESRDLTTVDFEFFSRDILDDFKGVDRNDIEIRQHRIILHKGEEMIEYKLINNKIIKV
    Newman          FLIESRDLTTVDFEFFSRDILDDFKGVDRNDIEIRQHRIILHKGEEMIEYKLINNKIIKV
    USA300_FPR3757  FLIESRDLTTVDFEFFSRDILDDFKGVDRNDIEIRQHRIILHKGEEMIEYKLINNKIIKV
                    ******:**************:******:*******:***********************

    COL             VNDRGNITMINNVTAFTANIYYKSIIKITITVKVGTNVQTKTIYV
    N315            VNDRGNITMINNVTAFTANIYYKSIIKITITVKVGTNLQTKTIYV
    NCTC8325        VNDRGNITMINNVTAFTANIYYKSIIKITITVKVGTNVQTKTIYV
    Newman          VNDRGNITMINNVTAFTANIYYKSIIKITITVKVGTNVQTKTIYV
    USA300_FPR3757  VNDRGNITMINNVTAFTANIYYKSIIKITITVKVGTNVQTKTIYV
                    *************************************:*******