Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004120000
  • symbol?: comGD
  • description?: Late competence protein ComGD, access of DNA to ComEA

      descriptions from strain specific annotations:

    • Late competence protein ComGD, access of DNA to ComEA
    • prepilin-type N-terminal cleavage/methylation domain-containing protein
    • Type II secretory pathway, pseudopilin PulG
    • ComG operon competence protein, putative
    • exported protein
    • ComG operon protein 4
  • strand?: -
  • coordinates?: 4393180..4393584
  • synteny block?: BlockID0031500
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1499 (comGD)
    08BA02176:
    C248_1584
    11819-97:
    MS7_1558
    71193:
    ST398NM01_1606
    ECT-R 2:
    ECTR2_1392
    ED133:
    SAOV_1541
    ED98:
    SAAV_1533
    HO 5096 0412:
    SAEMRSA15_14610
    JH1:
    SaurJH1_1633
    JH9:
    SaurJH9_1599
    JKD6008:
    SAA6008_01511 (pulG)
    JKD6159:
    SAA6159_01476 (pulG)
    LGA251:
    SARLGA251_14470
    M013:
    M013TW_1556
    MRSA252:
    SAR1618
    MSHR1132:
    SAMSHR1132_13820
    MSSA476:
    SAS1479
    Mu3:
    SAHV_1528
    Mu50:
    SAV1541
    MW2:
    MW1493
    RF122:
    SAB1413c
    ST398:
    SAPIG1606
    T0131:
    SAT0131_01635
    TCH60:
    HMPREF0772_11600 (comGD)
    TW20:
    SATW20_15370
    USA300_TCH1516:
    USA300HOU_1543 (pulG)
    VC40:
    SAVC_06950

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEKQLQIRKQSAFTMIEMLVVMMLISIFLLLTMTSKGLSNLRVIDDEANIISFITELNYI
    N315            ----MQIRKQSAFTMIEMLVVMMLISIFLLLTMTSKGLSNLRVIDDEANIISFITELNYI
    NCTC8325        MEKQLQIRKQSAFTMIEMLVVMMLISIFLLLTMTSKGLSNLRVIDDEANIISFITELNYI
    Newman          MEKQLQIRKQSAFTMIEMLVVMMLISIFLLLTMTSKGLSNLRVIDDEANIISFITELNYI
    USA300_FPR3757  MEKQLQIRKQSAFTMIEMLVVMMLISIFLLLTMTSKGLSNLRVIDDEANIISFITELNYI
                        :*******************************************************

    COL             KSQAIANQGYINVRFYENSDTIKVIENNKIRFLKLKVGKIINVAKVDIIAFDKKGNINKF
    N315            KSQAIANQGYINVRFYENSDTIKVIENNKIRFLKLKVGKIINVAKVDIIAFDKKGNINKF
    NCTC8325        KSQAIANQGYINVRFYENSDTIKVIENNKIRFLKLKVGKIINVAKVDIIAFDKKGNINKF
    Newman          KSQAIANQGYINVRFYENSDTIKVIENNKIRFLKLKVGKIINVAKVDIIAFDKKGNINKF
    USA300_FPR3757  KSQAIANQGYINVRFYENSDTIKVIENNNIRFLKLKVGKIINVAKVDIIAFDKKGNINKF
                    ****************************:*******************************

    COL             GSITIYNNNSIYRIIFHIEKGRIRYEKL
    N315            GSITIDNNNSIYRIIFHIEKGRIRYEKL
    NCTC8325        GSITIYNNNSIYRIIFHIEKGRIRYEKL
    Newman          GSITIYNNNSIYRIIFHIEKGRIRYEKL
    USA300_FPR3757  GSITIYNNNSIYRIIFHIEKGRIRYEKL
                    ***** **********************