From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1445 [new locus tag: NWMN_RS08155 ]
  • pan locus tag?: SAUPAN004120000
  • symbol: NWMN_1445
  • pan gene symbol?: comGD
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1445 [new locus tag: NWMN_RS08155 ]
  • symbol: NWMN_1445
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1614324..1614770
  • length: 447
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGAGAAGCAGTTGCAAATTAGAAAGCAGTCAGCATTTACTATGATTGAGATGCTTGTG
    GTAATGATGTTAATCAGTATATTTCTACTTTTGACAATGACATCTAAAGGATTAAGCAAT
    CTTAGAGTAATAGATGATGAGGCAAATATCATTTCTTTTATTACTGAATTGAATTATATT
    AAGTCGCAAGCTATAGCAAATCAAGGATATATCAATGTTAGATTTTATGAAAACAGTGAC
    ACTATTAAAGTAATAGAGAATAATAAAATACGATTTCTAAAATTAAAAGTAGGCAAAATA
    ATTAATGTTGCAAAAGTTGATATTATTGCCTTTGATAAAAAAGGGAATATCAATAAATTT
    GGTAGCATAACAATTTACAATAACAATTCAATTTATAGAATAATATTCCATATTGAAAAA
    GGAAGAATTCGTTATGAAAAGCTATAA
    60
    120
    180
    240
    300
    360
    420
    447

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1445 [new locus tag: NWMN_RS08155 ]
  • symbol: NWMN_1445
  • description: hypothetical protein
  • length: 148
  • theoretical pI: 10.3698
  • theoretical MW: 17213.3
  • GRAVY: 0.0945946

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cell structureCell envelopeSurface structuresVerru_Chthon cassette protein D (TIGR02596; HMM-score: 29.4)
    Cell structureCell envelopeSurface structuresprepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 24.6)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingprepilin-type N-terminal cleavage/methylation domain (TIGR02532; HMM-score: 24.6)
    Cellular processesCellular processesPathogenesistype II secretion system protein H (TIGR01708; HMM-score: 19.4)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype II secretion system protein H (TIGR01708; HMM-score: 19.4)
    Cell structureCell envelopeSurface structurestype IV pilus modification protein PilV (TIGR02523; HMM-score: 13)
    Genetic information processingProtein fateProtein modification and repairtype IV pilus modification protein PilV (TIGR02523; HMM-score: 13)
    Cell structureCell envelopeSurface structuresVerru_Chthon cassette protein C (TIGR02599; HMM-score: 11.5)
  • TheSEED:  
    DNA MetabolismDNA uptake, competenceLate competence Late competence protein ComGD, access of DNA to ComEA, FIG012777 
  • PFAM:
    no clan definedN_methyl; Prokaryotic N-terminal methylation motif (PF07963; HMM-score: 27.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.211
    • Ymax_pos: 38
    • Cmax: 0.175
    • Cmax_pos: 38
    • Smax: 0.402
    • Smax_pos: 35
    • Smean: 0.229
    • D: 0.218
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MEKQLQIRKQSAFTMIEMLVVMMLISIFLLLTMTSKGLSNLRVIDDEANIISFITELNYIKSQAIANQGYINVRFYENSDTIKVIENNKIRFLKLKVGKIINVAKVDIIAFDKKGNINKFGSITIYNNNSIYRIIFHIEKGRIRYEKL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]