From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004134000
  • symbol?: sodA
  • description?: superoxide dismutase

      descriptions from strain specific annotations:

    • superoxide dismutase
    • superoxide dismutase SodA
    • superoxide dismutase Mn/Fe family protein
    • Fe/Mn family superoxide dismutase
    • Superoxide dismutase [Mn] 1
    • Manganese superoxide dismutase
    • Superoxide dismutase (Fe)
    • superoxide dismutase, Mn
    • superoxide dismutase [Mn] (General stress protein 24)(GSP24)
  • strand?: -
  • coordinates?: 4402806..4403405
  • synteny block?: BlockID0031640
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1610 (sodA2)
    N315:
    SA1382 (sodA)
    NCTC8325:
    Newman:
    NWMN_1456 (sodA)
    USA300_FPR3757:
    04-02981:
    SA2981_1511 (sodA)
    08BA02176:
    C248_1596 (sodA)
    11819-97:
    MS7_1570 (sodA)
    71193:
    ST398NM01_1618
    ECT-R 2:
    ECTR2_1403
    ED133:
    SAOV_1553
    ED98:
    SAAV_1545 (sodA2)
    HO 5096 0412:
    SAEMRSA15_14730 (sodA)
    JH1:
    SaurJH1_1645
    JH9:
    SaurJH9_1611
    JKD6008:
    SAA6008_01522 (sodA)
    JKD6159:
    SAA6159_01488 (sodA)
    LGA251:
    SARLGA251_14590 (sodA)
    M013:
    M013TW_1568
    MRSA252:
    SAR1630 (sodA)
    MSHR1132:
    SAMSHR1132_13930
    MSSA476:
    SAS1491
    Mu3:
    SAHV_1540 (sodA)
    Mu50:
    SAV1553 (sodA)
    MW2:
    MW1505 (sodA)
    RF122:
    SAB1425c (sodA)
    ST398:
    SAPIG1618
    T0131:
    SAT0131_01647 (purR)
    TCH60:
    HMPREF0772_11587 (sodA2)
    TW20:
    SATW20_15490 (sodA)
    USA300_TCH1516:
    USA300HOU_1555 (sodA)
    VC40:
    SAVC_07015

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAFELPKLPYAFDALEPHFDKETMEIHHDRHHNTYVTKLNAAVEGTDLESKSIEEIVANL
    N315            MAFELPKLPYAFDALEPHFDKETMEIHHDRHHNTYVTKLNAAVEGTDLESKSIEEIVANL
    NCTC8325        MAFELPKLPYAFDALEPHFDKETMEIHHDRHHNTYVTKLNAAVEGTDLESKSIEEIVANL
    Newman          MAFELPKLPYAFDALEPHFDKETMEIHHDRHHNTYVTKLNAAVEGTDLESKSIEEIVANL
    USA300_FPR3757  MAFELPKLPYAFDALEPHFDKETMEIHHDRHHNTYVTKLNAAVEGTDLESKSIEEIVANL
                    ************************************************************

    COL             DSVPANIQTAVRNNGGGHLNHSLFWELLSPNSEEKGTVVEKIKEQWGSLEEFKKEFADKA
    N315            DSVPANIQTAVRNNGGGHLNHSLFWELLSPNSEEKGTVVEKIKEQWGSLEEFKKEFADKA
    NCTC8325        DSVPANIQTAVRNNGGGHLNHSLFWELLSPNSEEKGTVVEKIKEQWGSLEEFKKEFADKA
    Newman          DSVPANIQTAVRNNGGGHLNHSLFWELLSPNSEEKGTVVEKIKEQWGSLEEFKKEFADKA
    USA300_FPR3757  DSVPANIQTAVRNNGGGHLNHSLFWELLSPNSEEKGTVVEKIKEQWGSLEEFKKEFADKA
                    ************************************************************

    COL             AARFGSGWAWLVVNNGQLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPDYIG
    N315            AARFGSGWAWLVVNNGQLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPDYIG
    NCTC8325        AARFGSGWAWLVVNNGQLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPDYIG
    Newman          AARFGSGWAWLVVNNGQLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPDYIG
    USA300_FPR3757  AARFGSGWAWLVVNNGQLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPDYIG
                    ************************************************************

    COL             AFWNVVNWEKVDELYNATK
    N315            AFWNVVNWEKVDELYNATK
    NCTC8325        AFWNVVNWEKVDELYNATK
    Newman          AFWNVVNWEKVDELYNATK
    USA300_FPR3757  AFWNVVNWEKVDELYNATK
                    *******************