From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004138000
  • symbol?: nfo
  • description?: endonuclease IV

      descriptions from strain specific annotations:

    • endonuclease IV
    • endonuclease
    • apurinic endonuclease (APN1) family protein
    • deoxyribonuclease IV (phage-T(4)-induced)
    • probable endonuclease 4 (Endonuclease IV)(Endodeoxyribonuclease IV)
    • putative endonuclease 4
  • strand?: -
  • coordinates?: 4405901..4406791
  • synteny block?: BlockID0031680
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1614 (nfo)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1515
    08BA02176:
    C248_1600
    11819-97:
    MS7_1574 (nfo)
    71193:
    ST398NM01_1622
    ECT-R 2:
    ECTR2_1407
    ED133:
    SAOV_1557
    ED98:
    SAAV_1549 (nfo)
    HO 5096 0412:
    SAEMRSA15_14770
    JH1:
    SaurJH1_1649
    JH9:
    SaurJH9_1615
    JKD6008:
    SAA6008_01526 (nfo)
    JKD6159:
    SAA6159_01492 (nfo)
    LGA251:
    SARLGA251_14630
    M013:
    M013TW_1572
    MRSA252:
    SAR1634
    MSHR1132:
    SAMSHR1132_13970
    MSSA476:
    SAS1495
    Mu3:
    SAHV_1544
    Mu50:
    SAV1557
    MW2:
    MW1509
    RF122:
    SAB1429c
    ST398:
    SAPIG1622
    T0131:
    SAT0131_01651 (glmU)
    TCH60:
    HMPREF0772_11583 (nfo)
    TW20:
    SATW20_15530
    USA300_TCH1516:
    USA300HOU_1559 (nfo)
    VC40:
    SAVC_07035

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLLGSHVSMSGKKMLEGSAIEAHEYGETTFMIYTGAPQNTRRKSIEDLNITKGHEVMEKY
    N315            MLLGSHVSMSGKKMLEGSAIEAYEYGETTFMIYTGAPQNTRRKSIEDLNITKGHEVMEKY
    NCTC8325        MLLGSHVSMSGKKMLEGSAIEAHEYGETTFMIYTGAPQNTRRKSIEDLNITKGHEVMEKY
    Newman          MLLGSHVSMSGKKMLEGSAIEAHEYGETTFMIYTGAPQNTRRKSIEDLNITKGHEVMEKY
    USA300_FPR3757  MLLGSHVSMSGKKMLEGSAIEAHEYGETTFMIYTGAPQNTRRKSIEDLNITKGHEVMEKY
                    **********************:*************************************

    COL             GLSNIVVHAPYIINIANTTKPETFNLGVDFLQQEIERTQAIGAKDIVLHPGAHVGAGVDA
    N315            GLSNIVVHAPYIINIANTTKPETFNLGVDFLQQEIERTQAIGAKDIVLHPGAHVGAGVDA
    NCTC8325        GLSNIVVHAPYIINIANTTKPETFNLGVDFLQQEIERTQAIGAKDIVLHPGAHVGAGVDA
    Newman          GLSNIVVHAPYIINIANTTKPETFNLGVDFLQQEIERTQAIGAKDIVLHPGAHVGAGVDA
    USA300_FPR3757  GLSNIVVHAPYIINIANTTKPETFNLGVDFLQQEIERTQAIGAKDIVLHPGAHVGAGVDA
                    ************************************************************

    COL             GINKIIEGLNEVLTNDNNVRIALETMAGKGTEIGRSFEELARIIDGVHNNERLSVCFDTC
    N315            GINKIIEGLNEVLTNDNNVRIALETMAGKGTEIGRSFEELARIIDGVHNNERLSVCFDTC
    NCTC8325        GINKIIEGLNEVLTNDNNVRIALETMAGKGTEIGRSFEELARIIDGVHNNERLSVCFDTC
    Newman          GINKIIEGLNEVLTNDNNVRIALETMAGKGTEIGRSFEELARIIDGVHNNERLSVCFDTC
    USA300_FPR3757  GINKIIEGLNEVLTNDNNVRIALETMAGKGTEIGRSFEELARIIDGVHNNERLSVCFDTC
                    ************************************************************

    COL             HTHDAGYNVKEDFDGVLNEFDKIIGVDRIKVVHVNDSKNDRGAQKDRHENIGFGYIGFDA
    N315            HTHDAGYNVKEDFDGVLNEFDKIIGVDRIKVVHVNDSKNDRGAQKDRHENIGFGYIGFDA
    NCTC8325        HTHDAGYNVKEDFDGVLNEFDKIIGVDRIKVVHVNDSKNDRGAQKDRHENIGFGYIGFDA
    Newman          HTHDAGYNVKEDFDGVLNEFDKIIGVDRIKVVHVNDSKNDRGAQKDRHENIGFGYIGFDA
    USA300_FPR3757  HTHDAGYNVKEDFDGVLNEFDKIIGVDRIKVVHVNDSKNDRGAQKDRHENIGFGYIGFDA
                    ************************************************************

    COL             LNYIVHHDSFKDIPKILETPYVGEDKKNKKPPYKLEIEMLKQQQFDPELKNKVMQQ
    N315            LNYIVHHDSFKDIPKILETPYVGEDKKNKKPPYKLEIEMLKQQQFDPELKNKVMQQ
    NCTC8325        LNYIVHHDSFKDIPKILETPYVGEDKKNKKPPYKLEIEMLKQQQFDPELKNKVMQQ
    Newman          LNYIVHHDSFKDIPKILETPYVGEDKKNKKPPYKLEIEMLKQQQFDPELKNKVMQQ
    USA300_FPR3757  LNYIVHHDSFKDIPKILETPYVGEDKKNKKPPYKLEIEMLKQQQFDPELKNKVMQQ
                    ********************************************************