From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1386 [new locus tag: SA_RS07840 ]
  • pan locus tag?: SAUPAN004138000
  • symbol: SA1386
  • pan gene symbol?: nfo
  • synonym:
  • product: endonuclease IV

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1386 [new locus tag: SA_RS07840 ]
  • symbol: SA1386
  • product: endonuclease IV
  • replicon: chromosome
  • strand: -
  • coordinates: 1591110..1592000
  • length: 891
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGTTATTAGGATCACATGTTTCAATGAGTGGTAAAAAGATGTTAGAAGGTTCTGCTATA
    GAAGCGTATGAATATGGTGAAACAACATTTATGATTTATACTGGTGCACCTCAAAACACG
    CGCCGTAAAAGTATTGAAGATTTAAATATAACTAAAGGTCATGAAGTGATGGAAAAATAT
    GGCTTATCTAATATTGTTGTTCATGCACCATACATCATTAATATTGCAAATACAACCAAA
    CCAGAAACGTTTAATCTTGGTGTAGATTTCTTGCAACAAGAAATTGAAAGAACGCAAGCT
    ATAGGCGCTAAAGATATTGTATTACATCCAGGTGCGCATGTTGGAGCTGGTGTTGATGCC
    GGAATTAATAAGATTATTGAAGGATTAAATGAAGTTTTAACGAATGACAATAATGTACGT
    ATTGCGCTTGAAACGATGGCAGGTAAAGGTACAGAGATTGGTCGCTCGTTTGAAGAGTTA
    GCACGTATTATTGATGGAGTTCATAATAACGAACGTTTATCAGTATGTTTTGATACATGT
    CATACGCATGATGCTGGATATAATGTGAAAGAGGACTTTGATGGCGTATTAAATGAATTT
    GATAAAATTATTGGAGTCGACAGAATCAAAGTTGTTCATGTCAATGATTCTAAAAATGAC
    CGTGGCGCTCAAAAAGACCGACATGAAAATATTGGCTTCGGTTACATTGGTTTTGATGCA
    TTAAATTACATTGTGCATCATGATAGTTTTAAAGATATTCCGAAAATCTTAGAAACACCT
    TATGTTGGTGAAGATAAGAAAAATAAAAAACCGCCATATAAACTTGAAATTGAAATGTTA
    AAACAACAGCAATTTGACCCAGAATTAAAAAATAAGGTTATGCAACAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    891

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1386 [new locus tag: SA_RS07840 ]
  • symbol: SA1386
  • description: endonuclease IV
  • length: 296
  • theoretical pI: 5.75286
  • theoretical MW: 33184.3
  • GRAVY: -0.464865

Function[edit source | edit]

  • reaction:
    EC 3.1.21.2?  ExPASy
    Deoxyribonuclease IVEndonucleolytic cleavage to 5'-phosphooligonucleotide end-products
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairapurinic endonuclease (APN1) (TIGR00587; HMM-score: 332.3)
  • TheSEED:  
    DNA MetabolismDNA repairDNA repair, bacterial Endonuclease IV (EC 3.1.21.2) 
  • PFAM:
    TIM_barrel (CL0036) AP_endonuc_2; Xylose isomerase-like TIM barrel (PF01261; HMM-score: 130.5)
    no clan definedUDG; Uracil DNA glycosylase superfamily (PF03167; HMM-score: 19.7)
    TFIIA_gamma_N; Transcription initiation factor IIA, gamma subunit, helical domain (PF02268; HMM-score: 12.6)
    DASH_Dad1; DASH complex subunit Dad1 (PF08649; HMM-score: 11.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Zn2+
  • effectors:
  • protein partners:
    SA1533(ackA)acetate kinase  [1] (data from MRSA252)
    SA1984(asp23)alkaline shock protein 23  [1] (data from MRSA252)
    SA0471(cysK)hypothetical protein  [1] (data from MRSA252)
    SA1409(dnaK)molecular chaperone DnaK  [1] (data from MRSA252)
    SA0731(eno)phosphopyruvate hydratase  [1] (data from MRSA252)
    SA1553(fhs)formate--tetrahydrofolate ligase  [1] (data from MRSA252)
    SA1029(ftsZ)cell division protein FtsZ  [1] (data from MRSA252)
    SA0727(gap)glyceraldehyde-3-phosphate dehydrogenase  [1] (data from MRSA252)
    SA1510(gapB)glyceraldehyde 3-phosphate dehydrogenase 2  [1] (data from MRSA252)
    SA1305(hu)DNA-binding protein II  [1] (data from MRSA252)
    SA2400(mqo2)malate:quinone oxidoreductase  [1] (data from MRSA252)
    SA2334(mvaS)3-hydroxy-3-methylglutaryl-CoA synthase  [1] (data from MRSA252)
    SA1244(odhB)dihydrolipoamide succinyltransferase  [1] (data from MRSA252)
    SA0944(pdhB)pyruvate dehydrogenase E1 component subunit beta  [1] (data from MRSA252)
    SA0945(pdhC)branched-chain alpha-keto acid dehydrogenase E2 subunit  [1] (data from MRSA252)
    SA0946(pdhD)dihydrolipoamide dehydrogenase  [1] (data from MRSA252)
    SA1520(pykA)pyruvate kinase  [1] (data from MRSA252)
    SA0496(rplA)50S ribosomal protein L1  [1] (data from MRSA252)
    SA2044(rplB)50S ribosomal protein L2  [1] (data from MRSA252)
    SA2033(rplF)50S ribosomal protein L6  [1] (data from MRSA252)
    SA0497(rplJ)50S ribosomal protein L10  [1] (data from MRSA252)
    SA2029(rplO)50S ribosomal protein L15  [1] (data from MRSA252)
    SA1084(rplS)50S ribosomal protein L19  [1] (data from MRSA252)
    SA1473(rplU)50S ribosomal protein L21  [1] (data from MRSA252)
    SA2042(rplV)50S ribosomal protein L22  [1] (data from MRSA252)
    SA2045(rplW)50S ribosomal protein L23  [1] (data from MRSA252)
    SA2031(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    SA2024(rpsK)30S ribosomal protein S11  [1] (data from MRSA252)
    SA1245(sucA)2-oxoglutarate dehydrogenase E1  [1] (data from MRSA252)
    SA0506(tuf)elongation factor Tu  [1] (data from MRSA252)
    SA0627hypothetical protein  [1] (data from MRSA252)
    SA0707hypothetical protein  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.181
    • Ymax_pos: 11
    • Cmax: 0.201
    • Cmax_pos: 23
    • Smax: 0.456
    • Smax_pos: 3
    • Smean: 0.304
    • D: 0.229
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLLGSHVSMSGKKMLEGSAIEAYEYGETTFMIYTGAPQNTRRKSIEDLNITKGHEVMEKYGLSNIVVHAPYIINIANTTKPETFNLGVDFLQQEIERTQAIGAKDIVLHPGAHVGAGVDAGINKIIEGLNEVLTNDNNVRIALETMAGKGTEIGRSFEELARIIDGVHNNERLSVCFDTCHTHDAGYNVKEDFDGVLNEFDKIIGVDRIKVVHVNDSKNDRGAQKDRHENIGFGYIGFDALNYIVHHDSFKDIPKILETPYVGEDKKNKKPPYKLEIEMLKQQQFDPELKNKVMQQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]