From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004140000
  • symbol?:
  • description?: Nif3-like dinuclear metal center hexameric protein

      descriptions from strain specific annotations:

    • Nif3-like dinuclear metal center hexameric protein
    • NIF3 (NGG1p interacting factor 3) family protein
    • NIF3-like protein
  • strand?: -
  • coordinates?: 4408261..4409361
  • synteny block?: BlockID0031700
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1517
    08BA02176:
    C248_1602
    11819-97:
    MS7_1576
    71193:
    ST398NM01_1624
    ECT-R 2:
    ECTR2_1409
    ED133:
    SAOV_1559
    ED98:
    SAAV_1551
    HO 5096 0412:
    SAEMRSA15_14790
    JH1:
    SaurJH1_1651
    JH9:
    SaurJH9_1617
    JKD6008:
    SAA6008_01528
    JKD6159:
    SAA6159_01494
    LGA251:
    SARLGA251_14650
    M013:
    M013TW_1574
    MRSA252:
    SAR1636
    MSHR1132:
    SAMSHR1132_13990
    MSSA476:
    SAS1497
    Mu3:
    SAHV_1546
    Mu50:
    SAV1559
    MW2:
    MW1511
    RF122:
    SAB1431c
    ST398:
    SAPIG1624
    T0131:
    SAT0131_01653 (prs)
    TCH60:
    HMPREF0772_11581
    TW20:
    SATW20_15550
    USA300_TCH1516:
    USA300HOU_1561
    VC40:
    SAVC_07045

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIADLMTLLDHHVPFSTAESWDNVGLLIGDEDVEVTGVLTALDCTLEVVNEAIEKGYNT
    N315            MKIADLMTLLDHHVPFSTAESWDNVGLLIGDGDVEVTGVLTALDCTLEVVNEAIEKGYNT
    NCTC8325        MKIADLMTLLDHHVPFSTAESWDNVGLLIGDEDVEVTGVLTALDCTLEVVNEAIEKGYNT
    Newman          MKIADLMTLLDHHVPFSTAESWDNVGLLIGDEDVEVTGVLTALDCTLEVVNEAIEKGYNT
    USA300_FPR3757  MKIADLMTLLDHHVPFSTAESWDNVGLLIGDEDVEVTGVLTALDCTLEVVNEAIEKGYNT
                    ******************************* ****************************

    COL             IISHHPLIFKGVTSLKANGYGLIIRKLIQHDINLIAMHTNLDVNPYGVNMMLAKAMGLKN
    N315            IISHHPLIFKGVTSLKANGYGLIIRKLIQHDINLIAMHTNLDVNPYGVNMMLAKAMGLKN
    NCTC8325        IISHHPLIFKGVTSLKANGYGLIIRKLIQHDINLIAMHTNLDVNPYGVNMMLAKAMGLKN
    Newman          IISHHPLIFKGVTSLKANGYGLIIRKLIQHDINLIAMHTNLDVNPYGVNMMLAKAMGLKN
    USA300_FPR3757  IISHHPLIFKGVTSLKANGYGLIIRKLIQHDINLIAMHTNLDVNPYGVNMMLAKAMGLKN
                    ************************************************************

    COL             ISIINNQQDVYYKVQTYIPKDNVGPFKDKLSENGLAQEGNYEYCFFESEGRGQFKPVGEA
    N315            ISIINNQQDVYYKVQTYIPKDNVGPFKDKLSENGLAQEGNYEYCFFESEGRGQFKPVGEA
    NCTC8325        ISIINNQQDVYYKVQTYIPKDNVGPFKDKLSENGLAQEGNYEYCFFESEGRGQFKPVGEA
    Newman          ISIINNQQDVYYKVQTYIPKDNVGPFKDKLSENGLAQEGNYEYCFFESEGRGQFKPVGEA
    USA300_FPR3757  ISIINNQQDVYYKVQTYIPKDNVGPFKDKLSENGLAQEGNYEYCFFESEGRGQFKPVGEA
                    ************************************************************

    COL             NPTIGQIDKIEYVDEVKIEFMIDAYQKSRAEQLIKQYHPYETPVFDFIEIKQTSLYGLGV
    N315            NPTIGQIDKIEDVDEVKIEFMIDAYQKSRAEQLIKQYHPYETPVFDFIEIKQTSLYGLGV
    NCTC8325        NPTIGQIDKIEYVDEVKIEFMIDAYQKSRAEQLIKQYHPYETPVFDFIEIKQTSLYGLGV
    Newman          NPTIGQIDKIEYVDEVKIEFMIDAYQKSRAEQLIKQYHPYETPVFDFIEIKQTSLYGLGV
    USA300_FPR3757  NPTIGQIDKIEYVDEVKIEFMIDAYQKSRAEQLIKQYHPYETPVFDFIEIKQTSLYGLGV
                    *********** ************************************************

    COL             MAEVDNQMTLEDFAADIKSKLNIPSVRFVGESNQKIKRIAIIGGSGIGYEYQAVQQGADV
    N315            MAEVDNQMTLEDFAADIKSKLNIPSVRFVGESNQKIKRIAIIGGSGIGYEYQAVQQGADV
    NCTC8325        MAEVDNQMTLEDFAADIKSKLNIPSVRFVGESNQKIKRIAIIGGSGIGYEYQAVQQGADV
    Newman          MAEVDNQMTLEDFAADIKSKLNIPSVRFVGESNQKIKRIAIIGGSGIGYEYQAVQQGADV
    USA300_FPR3757  MAEVDNQMTLEDFAADIKSKLNIPSVRFVGESNQKIKRIAIIGGSGIGYEYQAVQQGADV
                    ************************************************************

    COL             FVTGDIKHHDALDAKIHGVNLIDINHYSEYVMKEGLKALLMNWFNTEKINLDVEASTINT
    N315            FVTGDIKHHDALDAKIHGVNLIDINHYSEYVMKEGLKTLLMNWFNIEKINIDVEASTINT
    NCTC8325        FVTGDIKHHDALDAKIHGVNLIDINHYSEYVMKEGLKALLMNWFNTEKINLDVEASTINT
    Newman          FVTGDIKHHDALDAKIHGVNLIDINHYSEYVMKEGLKALLMNWFNTEKINLDVEASTINT
    USA300_FPR3757  FVTGDIKHHDALDAKIHGVNLIDINHYSEYVMKEGLKALLMNWFNTEKINLDVEASTINT
                    *************************************:******* ****:*********

    COL             DPFQYI
    N315            DPFQYI
    NCTC8325        DPFQYI
    Newman          DPFQYI
    USA300_FPR3757  DPFQYI
                    ******