Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004142000
  • symbol?: sigA
  • description?: RNA polymerase sigma factor RpoD

      descriptions from strain specific annotations:

    • RNA polymerase sigma factor RpoD
    • RNA polymerase sigma-70 factor RpoD
    • RNA polymerase sigma factor rpoD (Sigma-A) (Sigma-43)
    • DNA-directed RNA polymerase sigma subunit RpoD
  • strand?: -
  • coordinates?: 4410173..4411279
  • synteny block?: BlockID0031720
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1618 (rpoD)
    N315:
    SA1390 (sigA)
    NCTC8325:
    Newman:
    NWMN_1464 (sigA)
    USA300_FPR3757:
    04-02981:
    SA2981_1519 (rpoD)
    08BA02176:
    C248_1604 (rpoD)
    11819-97:
    MS7_1578 (rpoD)
    71193:
    ST398NM01_1626
    ECT-R 2:
    ECTR2_1411 (rpoD)
    ED133:
    SAOV_1561 (rpoD)
    ED98:
    SAAV_1553 (rpoD)
    HO 5096 0412:
    SAEMRSA15_14810 (rpoD)
    JH1:
    SaurJH1_1653
    JH9:
    SaurJH9_1619
    JKD6008:
    SAA6008_01530 (rpoD)
    JKD6159:
    SAA6159_01496 (rpoD)
    LGA251:
    SARLGA251_14670 (rpoD)
    M013:
    M013TW_1576
    MRSA252:
    SAR1638 (rpoD)
    MSHR1132:
    SAMSHR1132_14010
    MSSA476:
    SAS1499
    Mu3:
    SAHV_1548 (sigA)
    Mu50:
    SAV1561 (sigA)
    MW2:
    MW1513 (sigA)
    RF122:
    SAB1433c (rpoD)
    ST398:
    SAPIG1626
    T0131:
    SAT0131_01656
    TCH60:
    HMPREF0772_11579 (rpoD)
    TW20:
    SATW20_15570 (rpoD)
    USA300_TCH1516:
    USA300HOU_1563 (rpoD)
    VC40:
    SAVC_07055

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSDNTVKIKKQTIDPTLTLEDVKKQLIEKGKKEGHLSHEEIAEKLQNFDIDSDQMDDFFD
    N315            MSDNTVKIKKQTIDPTLTLEDVKKQLIEKGKKEGHLSHEEIAEKLQNFDIDSDQMDDFFD
    NCTC8325        MSDNTVKIKKQTIDPTLTLEDVKKQLIEKGKKEGHLSHEEIAEKLQNFDIDSDQMDDFFD
    Newman          MSDNTVKIKKQTIDPTLTLEDVKKQLIEKGKKEGHLSHEEIAEKLQNFDIDSDQMDDFFD
    USA300_FPR3757  MSDNTVKIKKQTIDPTLTLEDVKKQLIEKGKKEGHLSHEEIAEKLQNFDIDSDQMDDFFD
                    ************************************************************

    COL             QLNDNDISLVNEKDSSDTDEKLNPSDLSAPPGVKINDPVRMYLKEIGRVNLLSAQEEIEL
    N315            QLNDNDISLVNEKDSSDTDEKLNPSDLSAPPGVKINDPVRMYLKEIGRVNLLSAQEEIEL
    NCTC8325        QLNDNDISLVNEKDSSDTDEKLNPSDLSAPPGVKINDPVRMYLKEIGRVNLLSAQEEIEL
    Newman          QLNDNDISLVNEKDSSDTDEKLNPSDLSAPPGVKINDPVRMYLKEIGRVNLLSAQEEIEL
    USA300_FPR3757  QLNDNDISLVNEKDSSDTDEKLNPSDLSAPPGVKINDPVRMYLKEIGRVNLLSAQEEIEL
                    ************************************************************

    COL             AKRIEQGDEVAKSRLAEANLRLVVSIAKRYVGRGMLFLDLIQEGNMGLIKAVEKFDFNKG
    N315            AKRIEQGDEVAKSRLAEANLRLVVSIAKRYVGRGMLFLDLIQEGNMGLIKAVEKFDFNKG
    NCTC8325        AKRIEQGDEVAKSRLAEANLRLVVSIAKRYVGRGMLFLDLIQEGNMGLIKAVEKFDFNKG
    Newman          AKRIEQGDEVAKSRLAEANLRLVVSIAKRYVGRGMLFLDLIQEGNMGLIKAVEKFDFNKG
    USA300_FPR3757  AKRIEQGDEVAKSRLAEANLRLVVSIAKRYVGRGMLFLDLIQEGNMGLIKAVEKFDFNKG
                    ************************************************************

    COL             FKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLIRVQRQLLQDLGRDPAPEEIG
    N315            FKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLIRVQRQLLQDLGRDPAPEEIG
    NCTC8325        FKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLIRVQRQLLQDLGRDPAPEEIG
    Newman          FKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLIRVQRQLLQDLGRDPAPEEIG
    USA300_FPR3757  FKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLIRVQRQLLQDLGRDPAPEEIG
                    ************************************************************

    COL             EEMDLPAEKVREILKIAQEPVSLETPIGEEDDSHLGDFIEDQEAQSPSDHAAYELLKEQL
    N315            EEMDLPAEKVREVLKIAQEPVSLETPIGEEDDSHLGDFIEDQEAQSPSDHAAYELLKEQL
    NCTC8325        EEMDLPAEKVREILKIAQEPVSLETPIGEEDDSHLGDFIEDQEAQSPSDHAAYELLKEQL
    Newman          EEMDLPAEKVREILKIAQEPVSLETPIGEEDDSHLGDFIEDQEAQSPSDHAAYELLKEQL
    USA300_FPR3757  EEMDLPAEKVREILKIAQEPVSLETPIGEEDDSHLGDFIEDQEAQSPSDHAAYELLKEQL
                    ************:***********************************************

    COL             EDVLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLRHPSRS
    N315            EDVLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLRHPSRS
    NCTC8325        EDVLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLRHPSRS
    Newman          EDVLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLRHPSRS
    USA300_FPR3757  EDVLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLRHPSRS
                    ************************************************************

    COL             KRLKDFMD
    N315            KRLKDFMD
    NCTC8325        KRLKDFMD
    Newman          KRLKDFMD
    USA300_FPR3757  KRLKDFMD
                    ********