From AureoWiki
Jump to: navigation, search
NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1390 [new locus tag: SA_RS07860 ]
  • pan locus tag?: SAUPAN004142000
  • symbol: sigA
  • pan gene symbol?: sigA
  • synonym:
  • product: RNA polymerase sigma factor RpoD

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA1390 [new locus tag: SA_RS07860 ]
  • symbol: sigA
  • product: RNA polymerase sigma factor RpoD
  • replicon: chromosome
  • strand: -
  • coordinates: 1595381..1596487
  • length: 1107
  • essential: yes DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    ATGTCTGATAACACAGTTAAAATTAAAAAACAAACAATTGATCCGACATTAACATTAGAA
    GATGTTAAGAAGCAATTAATTGAAAAAGGTAAAAAAGAGGGTCATTTAAGTCATGAAGAA
    ATTGCTGAAAAACTTCAGAATTTTGATATCGACTCTGATCAAATGGATGATTTCTTTGAT
    CAATTAAATGATAATGATATTTCACTAGTTAATGAAAAAGATAGTTCAGATACTGACGAG
    AAACTGAATCCAAGTGATCTTAGTGCCCCTCCAGGTGTTAAAATAAATGACCCAGTTCGT
    ATGTACCTTAAAGAAATTGGGCGTGTTAACTTATTAAGTGCACAAGAAGAAATCGAATTA
    GCCAAACGTATTGAACAAGGTGATGAAGTAGCAAAATCAAGACTTGCAGAAGCGAACTTA
    CGTTTAGTTGTAAGTATTGCTAAAAGATACGTAGGTCGTGGTATGTTATTCCTTGATTTA
    ATCCAAGAAGGTAATATGGGTCTTATTAAAGCTGTTGAAAAATTTGACTTTAACAAAGGA
    TTTAAGTTTTCAACATATGCAACATGGTGGATTAGACAAGCAATCACTCGTGCAATTGCT
    GACCAAGCACGTACGATTCGTATCCCTGTGCATATGGTAGAAACAATTAATAAATTAATT
    CGTGTTCAACGTCAATTATTACAGGACTTAGGTCGAGATCCAGCACCAGAAGAAATTGGT
    GAAGAAATGGATTTACCAGCAGAAAAAGTTCGTGAAGTTTTAAAAATTGCGCAAGAACCT
    GTTTCATTAGAAACACCAATTGGTGAAGAAGATGATAGTCATTTAGGAGACTTTATTGAG
    GATCAGGAAGCACAAAGTCCTTCAGATCATGCTGCTTATGAATTATTAAAAGAGCAATTA
    GAAGATGTGCTTGATACATTAACTGATAGAGAAGAAAATGTATTACGATTAAGATTTGGT
    CTTGATGACGGCAGAACAAGAACACTTGAAGAAGTTGGTAAAGTTTTCGGTGTTACACGT
    GAACGTATTCGACAAATTGAAGCAAAAGCACTTAGAAAATTAAGACATCCAAGTCGTAGT
    AAACGTTTGAAAGACTTTATGGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1107

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA1390 [new locus tag: SA_RS07860 ]
  • symbol: SigA
  • description: RNA polymerase sigma factor RpoD
  • length: 368
  • theoretical pI: 4.72503
  • theoretical MW: 42156.5
  • GRAVY: -0.630707

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingTranscriptionTranscription factorsRNA polymerase sigma factor RpoD (TIGR02393; HMM-score: 410.2)
    RNA polymerase sigma factor, cyanobacterial RpoD-like family (TIGR02997; HMM-score: 354.1)
    Cellular processesCellular processesAdaptations to atypical conditionsRNA polymerase sigma factor RpoS (TIGR02394; HMM-score: 323.6)
    Genetic information processingTranscriptionTranscription factorsRNA polymerase sigma factor RpoS (TIGR02394; HMM-score: 323.6)
    Cellular processesCellular processesAdaptations to atypical conditionsalternative sigma factor RpoH (TIGR02392; HMM-score: 162.7)
    Genetic information processingTranscriptionTranscription factorsalternative sigma factor RpoH (TIGR02392; HMM-score: 162.7)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 135.7)
    RNA polymerase sigma-70 factor, sigma-B/F/G subfamily (TIGR02980; HMM-score: 131.6)
    Cellular processesCellular processesSporulation and germinationRNA polymerase sigma-G factor (TIGR02850; HMM-score: 127.3)
    Genetic information processingTranscriptionTranscription factorsRNA polymerase sigma-G factor (TIGR02850; HMM-score: 127.3)
    RNA polymerase sigma factor, FliA/WhiG family (TIGR02479; HMM-score: 121.4)
    Cellular processesCellular processesSporulation and germinationRNA polymerase sigma-F factor (TIGR02885; HMM-score: 121.2)
    Genetic information processingTranscriptionTranscription factorsRNA polymerase sigma-F factor (TIGR02885; HMM-score: 121.2)
    Cellular processesCellular processesSporulation and germinationRNA polymerase sigma-K factor (TIGR02846; HMM-score: 115)
    Genetic information processingTranscriptionTranscription factorsRNA polymerase sigma-K factor (TIGR02846; HMM-score: 115)
    Cellular processesCellular processesSporulation and germinationRNA polymerase sigma-E factor (TIGR02835; HMM-score: 103.6)
    Genetic information processingTranscriptionTranscription factorsRNA polymerase sigma-E factor (TIGR02835; HMM-score: 103.6)
    RNA polymerase sigma-B factor (TIGR02941; HMM-score: 74.7)
    Cellular processesCellular processesSporulation and germinationRNA polymerase sigma-H factor (TIGR02859; HMM-score: 40.2)
    Genetic information processingTranscriptionTranscription factorsRNA polymerase sigma-H factor (TIGR02859; HMM-score: 40.2)
    RNA polymerase sigma-70 factor, TIGR02952 family (TIGR02952; HMM-score: 31.6)
    RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 (TIGR02984; HMM-score: 19.6)
    Genetic information processingDNA metabolismDegradation of DNAexodeoxyribonuclease VII, large subunit (TIGR00237; EC 3.1.11.6; HMM-score: 14)
    RNA polymerase sigma factor RpoE (TIGR02939; HMM-score: 13)
    Cellular processesCellular processesSporulation and germinationRNA polymerase sigma-I factor (TIGR02895; HMM-score: 12.5)
    Genetic information processingTranscriptionTranscription factorsRNA polymerase sigma-I factor (TIGR02895; HMM-score: 12.5)
    RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 12.4)
    Signal transductionRegulatory functionsDNA interactionsDNA-binding protein, Tfx family (TIGR00721; HMM-score: 12.3)
    RNA polymerase sigma-70 factor, TIGR02954 family (TIGR02954; HMM-score: 11.6)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersChlorophyll and bacteriochlorphylllight-independent protochlorophyllide reductase, N subunit (TIGR01279; EC 1.3.7.7; HMM-score: 11.2)
  • TheSEED:  
    RNA MetabolismTranscriptionTranscription initiation, bacterial sigma factors RNA polymerase sigma factor RpoD 
  • PFAM:
    HTH (CL0123) Sigma70_r3; Sigma-70 region 3 (PF04539; HMM-score: 106.9)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 81.1)
    Sigma70_r2; Sigma-70 region 2 (PF04542; HMM-score: 77.9)
    no clan definedSigma70_r1_2; Sigma-70 factor, region 1.2 (PF00140; HMM-score: 67.7)
    Sigma70_r1_1; Sigma-70 factor, region 1.1 (PF03979; HMM-score: 61.1)
    Exonuc_VII_L; Exonuclease VII, large subunit (PF02601; HMM-score: 16.6)
    HTH (CL0123) HTH_10; HTH DNA binding domain (PF04967; HMM-score: 13.1)
    no clan definedPolyA_pol_arg_C; Polymerase A arginine-rich C-terminus (PF12626; HMM-score: 12.5)
    DUF4107; Protein of unknown function (DUF4107) (PF13389; HMM-score: 11)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SA1305(hu)DNA-binding protein II  [1] (data from MRSA252)
    SA2023(rpoA)DNA-directed RNA polymerase subunit alpha  [1] (data from MRSA252)
    SA0500(rpoB)DNA-directed RNA polymerase subunit beta  [1] (data from MRSA252)
    SA0501(rpoC)DNA-directed RNA polymerase subunit beta'  [1] (data from MRSA252)
    SA1930(rpoE)DNA-directed RNA polymerase subunit delta  [1] (data from MRSA252)
    SA0108(sarH1)hypothetical protein  [1] (data from MRSA252)
    SA2089(sarR)hypothetical protein  [1] (data from MRSA252)
    SA0856(spxA)transcriptional regulator Spx  [1] (data from MRSA252)
    SA0941hypothetical protein  [1] (data from MRSA252)
    SA1665hypothetical protein  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.127
    • Ymax_pos: 31
    • Cmax: 0.105
    • Cmax_pos: 35
    • Smax: 0.209
    • Smax_pos: 24
    • Smean: 0.125
    • D: 0.126
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSDNTVKIKKQTIDPTLTLEDVKKQLIEKGKKEGHLSHEEIAEKLQNFDIDSDQMDDFFDQLNDNDISLVNEKDSSDTDEKLNPSDLSAPPGVKINDPVRMYLKEIGRVNLLSAQEEIELAKRIEQGDEVAKSRLAEANLRLVVSIAKRYVGRGMLFLDLIQEGNMGLIKAVEKFDFNKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLIRVQRQLLQDLGRDPAPEEIGEEMDLPAEKVREVLKIAQEPVSLETPIGEEDDSHLGDFIEDQEAQSPSDHAAYELLKEQLEDVLDTLTDREENVLRLRFGLDDGRTRTLEEVGKVFGVTRERIRQIEAKALRKLRHPSRSKRLKDFMD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]