From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004146000
  • symbol?: glyS
  • description?: glycyl-tRNA synthetase

      descriptions from strain specific annotations:

    • glycyl-tRNA synthetase
    • glycine--tRNA ligase
    • glycyl-tRNA synthetase subunit beta
    • putative glycyl-tRNA synthetase
  • strand?: +
  • coordinates?: 4415169..4416560
  • synteny block?: BlockID0031760
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1622 (glyS)
    N315:
    SA1394 (glyS)
    NCTC8325:
    Newman:
    NWMN_1468 (glyS)
    USA300_FPR3757:
    04-02981:
    SA2981_1523 (glyS)
    08BA02176:
    C248_1608
    11819-97:
    MS7_1582 (glyS)
    71193:
    ST398NM01_1630
    ECT-R 2:
    ECTR2_1415 (glyS)
    ED133:
    SAOV_1565 (glyS)
    ED98:
    SAAV_1557 (glyS)
    HO 5096 0412:
    SAEMRSA15_14850
    JH1:
    SaurJH1_1657
    JH9:
    SaurJH9_1623
    JKD6008:
    SAA6008_01534 (glyS)
    JKD6159:
    SAA6159_01500 (glyS)
    LGA251:
    SARLGA251_14710
    M013:
    M013TW_1580
    MRSA252:
    SAR1642
    MSHR1132:
    SAMSHR1132_14050
    MSSA476:
    SAS1503
    Mu3:
    SAHV_1552 (glyS)
    Mu50:
    SAV1565 (glyS)
    MW2:
    MW1517 (glyS)
    RF122:
    SAB1437 (glyS)
    ST398:
    SAPIG1630 (glyS)
    T0131:
    SAT0131_01660
    TCH60:
    HMPREF0772_11575 (glyS)
    TW20:
    SATW20_15610
    USA300_TCH1516:
    USA300HOU_1566 (glyS)
    VC40:
    SAVC_07075

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKDMDTIVSLAKHRGFVFPGSDIYGGLSNTWDYGPLGVELKNNVKKAWWQKFITQSPFN
    N315            MAKDMDTIVSLAKHRGFVFPGSDIYGGLSNTWDYGPLGVELKNNVKKAWWQKFITQSPFN
    NCTC8325        MAKDMDTIVSLAKHRGFVFPGSDIYGGLSNTWDYGPLGVELKNNVKKAWWQKFITQSPFN
    Newman          MAKDMDTIVSLAKHRGFVFPGSDIYGGLSNTWDYGPLGVELKNNVKKAWWQKFITQSPFN
    USA300_FPR3757  MAKDMDTIVSLAKHRGFVFPGSDIYGGLSNTWDYGPLGVELKNNVKKAWWQKFITQSPFN
                    ************************************************************

    COL             VGIDAAILMNPKVWEASGHLNNFNDPMIDNKDSKIRYRADKLIEDYMQDVKGDENFIADG
    N315            VGIDAAILMNPKVWEASGHLNNFNDPMIDNKDSKIRYRADKLIEDYMQDVKGDENFIADG
    NCTC8325        VGIDAAILMNPKVWEASGHLNNFNDPMIDNKDSKIRYRADKLIEDYMQDVKGDENFIADG
    Newman          VGIDAAILMNPKVWEASGHLNNFNDPMIDNKDSKIRYRADKLIEDYMQDVKGDENFIADG
    USA300_FPR3757  VGIDAAILMNPKVWEASGHLNNFNDPMIDNKDSKIRYRADKLIEDYMQDVKGDENFIADG
                    ************************************************************

    COL             LSFEQMKKIIDDEGIVCPVSKTANWTEIRQFNLMFKTFQGVTEDSTNEIFLRPETAQGIF
    N315            LSFEQMKKIIDDEGIVCPVSKTANWTEIRQFNLMFKTFQGVTEDSTNEIFLRPETAQGIF
    NCTC8325        LSFEQMKKIIDDEGIVCPVSKTANWTEIRQFNLMFKTFQGVTEDSTNEIFLRPETAQGIF
    Newman          LSFEQMKKIIDDEGIVCPVSKTANWTEIRQFNLMFKTFQGVTEDSTNEIFLRPETAQGIF
    USA300_FPR3757  LSFEQMKKIIDDEGIVCPVSKTANWTEIRQFNLMFKTFQGVTEDSTNEIFLRPETAQGIF
                    ************************************************************

    COL             VNYKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFIFRTREFEQMELEFFCKPGEEIEWQN
    N315            VNYKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFIFRTREFEQMELEFFCKPGEEIEWQN
    NCTC8325        VNYKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFIFRTREFEQMELEFFCKPGEEIEWQN
    Newman          VNYKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFIFRTREFEQMELEFFCKPGEEIEWQN
    USA300_FPR3757  VNYKNVQRSMRKKLPFGIGQIGKSFRNEITPGNFIFRTREFEQMELEFFCKPGEEIEWQN
                    ************************************************************

    COL             YWKTFASDWLTSLNMSSENMRLRDHDEDELSHYSNATTDIEYKFPFGWGELWGIASRTDF
    N315            YWKTFASDWLTSLNMSSENMRLRDHDEDELSHYSNATTDIEYKFPFGWGELWGIASRTDF
    NCTC8325        YWKTFASDWLTSLNMSSENMRLRDHDEDELSHYSNATTDIEYKFPFGWGELWGIASRTDF
    Newman          YWKTFASDWLTSLNMSSENMRLRDHDEDELSHYSNATTDIEYKFPFGWGELWGIASRTDF
    USA300_FPR3757  YWKTFASDWLTSLNMSSENMRLRDHDEDELSHYSNATTDIEYKFPFGWGELWGIASRTDF
                    ************************************************************

    COL             DLRKHAEHSGEDFRYHDPETNEKYIPYCIEPSLGADRVTLAFLCDAYDEEGVEGSKDART
    N315            DLRKHAEHSGEDFRYHDPETNEKYIPYCIEPSLGADRVTLAFLCDAYDEEGVEGSKDART
    NCTC8325        DLRKHAEHSGEDFRYHDPETNEKYIPYCIEPSLGADRVTLAFLCDAYDEEGVEGSKDART
    Newman          DLRKHAEHSGEDFRYHDPETNEKYIPYCIEPSLGADRVTLAFLCDAYDEEGVEGSKDART
    USA300_FPR3757  DLRKHAEHSGEDFRYHDPETNEKYIPYCIEPSLGADRVTLAFLCDAYDEEGVEGSKDART
                    ************************************************************

    COL             VLHFHPALAPYKAAILPLSKKLSGEAIKIFEQLSSKFSIDFDESQSIGKRYRRQDEIGTP
    N315            VLHFHPALAPYKAAILPLSKKLSGEAIKIFEQLSSKFSIDFDESQSIGKRYRRQDEIGTP
    NCTC8325        VLHFHPALAPYKAAILPLSKKLSGEAIKIFEQLSSKFSIDFDESQSIGKRYRRQDEIGTP
    Newman          VLHFHPALAPYKAAILPLSKKLSGEAIKIFEQLSSKFSIDFDESQSIGKRYRRQDEIGTP
    USA300_FPR3757  VLHFHPALAPYKAAILPLSKKLSGEAIKIFEQLSSKFSIDFDESQSIGKRYRRQDEIGTP
                    ************************************************************

    COL             YCVTFDFDSLEDNQVTVRDRDSMEQVRMPISELEAFLTEKTKF
    N315            YCVTFDFDSLEDNQVTVRDRDSMEQVRMPISELEAFLTEKTKF
    NCTC8325        YCVTFDFDSLEDNQVTVRDRDSMEQVRMPISELEAFLTEKTKF
    Newman          YCVTFDFDSLEDNQVTVRDRDSMEQVRMPISELEAFLTEKTKF
    USA300_FPR3757  YCVTFDFDSLEDNQVTVRDRDSMEQVRMPISELEAFLTEKTKF
                    *******************************************