From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004147000
  • symbol?: recO
  • description?: DNA repair protein RecO

      descriptions from strain specific annotations:

    • DNA repair protein RecO
    • RecO family DNA repair protein
    • DNA recombination and repair protein RecO
    • putative recombinational DNA repair protein (RecF pathway)
    • putative recombination protein O
    • recombination protein RecO
  • strand?: -
  • coordinates?: 4416749..4417495
  • synteny block?: BlockID0031770
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1469 (recO)
    USA300_FPR3757:
    04-02981:
    SA2981_1524 (recO)
    08BA02176:
    C248_1609
    11819-97:
    MS7_1583 (recO)
    71193:
    ST398NM01_1631
    ECT-R 2:
    ECTR2_1416 (recO)
    ED133:
    SAOV_1566
    ED98:
    SAAV_1558
    HO 5096 0412:
    SAEMRSA15_14860
    JH1:
    SaurJH1_1658
    JH9:
    SaurJH9_1624
    JKD6008:
    SAA6008_01535 (recO)
    JKD6159:
    SAA6159_01501 (recO)
    LGA251:
    SARLGA251_14720
    M013:
    M013TW_1581
    MRSA252:
    SAR1643
    MSHR1132:
    SAMSHR1132_14060
    MSSA476:
    SAS1504
    Mu3:
    SAHV_1553
    Mu50:
    SAV1566
    MW2:
    MW1518
    RF122:
    SAB1438c
    ST398:
    SAPIG1631 (recO)
    T0131:
    SAT0131_01661
    TCH60:
    HMPREF0772_11574 (recO)
    TW20:
    SATW20_15620
    USA300_TCH1516:
    USA300HOU_1567 (recO)
    VC40:
    SAVC_07080

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLMRQKGIIIKAVDYGESDKIITILNEHGAKVPLMARRAKKVKTGLQAQTQLFVYGLFIY
    N315            MLMRQKGIIIKAVDYGESDKIITILNEHGAKVPLMARRAKKVKTGLQAQTQLFVYGLFIY
    NCTC8325        --MRQKGIIIKAVDYGESDKIITILNEHGAKVPLMARRAKKVKTGLQAQTQLFVYGLFIY
    Newman          MLMRQKGIIIKAVDYGESDKIITILNEHGAKVPLMARRAKKVKTGLQAQTQLFVYGLFIY
    USA300_FPR3757  MLMRQKGIIIKAVDYGESDKIITILNEHGAKVPLMARRAKKVKTGLQAQTQLFVYGLFIY
                      **********************************************************

    COL             NQWRGMGTLNSVDVISQHYKLQMDLYVSSYAALAAETIERSMDEGDIAPYNYQLLQFVLE
    N315            NQWRGMGTLNSVDVISQHYKLQMDLYVSSYASLAAETIERSMDEGDIAPYNYQLLQFVLE
    NCTC8325        NQWRGMGTLNSVDVISQHYKLQMDLYVSSYAALAAETIERSMDEGDIAPYNYQLLQFVLE
    Newman          NQWRGMGTLNSVDVISQHYKLQMDLYVSSYAALAAETIERSMDEGDIAPYNYQLLQFVLE
    USA300_FPR3757  NQWRGMGTLNSVDVISQHYKLQMDLYVSSYAALAAETIERSMDEGDIAPYNYQLLQFVLE
                    *******************************:****************************

    COL             KIESGTSAQLMSVVVMLKCMKRFGFTASFNRCAVSGNDTQADLIGYSFKFDGAISRQEAS
    N315            KIESGTSAQLMSVVVMLKCMKRFGFTASFNRCAVSGNDTQADLIGYSFKFDGAISRQEAS
    NCTC8325        KIESGTSAQLMSVVVMLKCMKRFGFTASFNRCAVSGNDTQADLIGYSFKFDGAISRQEAS
    Newman          KIESGTSAQLMSVVVMLKCMKRFGFTASFNRCAVSGNDTQADLIGYSFKFDGAISRQEAS
    USA300_FPR3757  KIESGTSAQLMSVVVMLKCMKRFGFTASFNRCAVSGNDTQADLIGYSFKFDGAISRQEAS
                    ************************************************************

    COL             KDVHAVILSNKTLYLLDVLQKLPIDKMNSLNIHQEIIDEMSDIILMLYREYAGMFFKSQK
    N315            KDVHAVILSNKTLYLLDVLQKLPIDKMNSLNIHQEIIDEMSDIILMLYREYAGMFFKSQK
    NCTC8325        KDVHAVILSNKTLYLLDVLQKLPIDKMNSLNIHQEIIDEMSDIILMLYREYAGMFFKSQK
    Newman          KDVHAVILSNKTLYLLDVLQKLPIDKMNSLNIHQEIIDEMSDIILMLYREYAGMFFKSQK
    USA300_FPR3757  KDVHAVILSNKTLYLLDVLQKLPIDKMNSLNIHQEIIDEMSDIILMLYREYAGMFFKSQK
                    ************************************************************

    COL             LINQLKRLEQ
    N315            LINQLKRLEQ
    NCTC8325        LINQLKRLEQ
    Newman          LINQLKRLEQ
    USA300_FPR3757  LINQLKRLEQ
                    **********