From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1469 [new locus tag: NWMN_RS08280 ]
  • pan locus tag?: SAUPAN004147000
  • symbol: recO
  • pan gene symbol?: recO
  • synonym:
  • product: DNA repair protein RecO

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1469 [new locus tag: NWMN_RS08280 ]
  • symbol: recO
  • product: DNA repair protein RecO
  • replicon: chromosome
  • strand: -
  • coordinates: 1637815..1638567
  • length: 753
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    TTGTTAATGCGCCAAAAAGGGATTATCATCAAAGCAGTTGATTATGGTGAATCTGATAAA
    ATTATCACGATTTTAAATGAGCATGGTGCAAAAGTACCACTTATGGCAAGGCGTGCTAAA
    AAAGTTAAGACGGGTTTACAAGCGCAAACGCAATTGTTTGTTTATGGTTTGTTTATTTAC
    AATCAGTGGCGAGGTATGGGAACGTTAAATTCTGTAGATGTTATTAGTCAACATTATAAA
    TTACAAATGGACCTTTACGTAAGCAGTTATGCCGCTCTGGCAGCTGAAACTATTGAGCGC
    TCAATGGATGAAGGTGACATTGCACCATATAACTATCAATTATTACAATTTGTTCTTGAA
    AAAATAGAATCAGGTACATCTGCACAGTTAATGTCAGTCGTAGTTATGTTAAAGTGCATG
    AAACGATTTGGTTTTACTGCATCATTTAATCGCTGTGCTGTGAGTGGTAATGACACACAA
    GCAGATTTAATAGGTTATAGTTTTAAGTTTGACGGTGCGATTTCAAGGCAAGAGGCTTCT
    AAAGATGTACATGCAGTTATATTATCGAATAAAACACTATATTTATTAGATGTATTACAA
    AAATTACCGATAGATAAAATGAATTCATTGAATATCCATCAAGAAATTATTGATGAAATG
    TCAGATATCATTTTAATGTTATATCGTGAATATGCAGGTATGTTTTTTAAAAGTCAGAAA
    CTAATCAACCAATTAAAAAGATTGGAACAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    753

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1469 [new locus tag: NWMN_RS08280 ]
  • symbol: RecO
  • description: DNA repair protein RecO
  • length: 250
  • theoretical pI: 8.89118
  • theoretical MW: 28450
  • GRAVY: -0.044

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA repair protein RecO (TIGR00613; HMM-score: 259.7)
  • TheSEED:  
    DNA MetabolismDNA repairDNA repair, bacterial RecFOR pathway DNA recombination and repair protein RecO 
    CBSS-176299.4.peg.1292 DNA recombination and repair protein RecO 
  • PFAM:
    Zn_Beta_Ribbon (CL0167) RecO_C; Recombination protein O C terminal (PF02565; HMM-score: 90.4)
    OB (CL0021) RecO_N; Recombination protein O N terminal (PF11967; HMM-score: 59.8)
    RecO_N_2; RecO N terminal (PF13114; HMM-score: 25)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.115
    • Ymax_pos: 49
    • Cmax: 0.127
    • Cmax_pos: 49
    • Smax: 0.147
    • Smax_pos: 10
    • Smean: 0.092
    • D: 0.106
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLMRQKGIIIKAVDYGESDKIITILNEHGAKVPLMARRAKKVKTGLQAQTQLFVYGLFIYNQWRGMGTLNSVDVISQHYKLQMDLYVSSYAALAAETIERSMDEGDIAPYNYQLLQFVLEKIESGTSAQLMSVVVMLKCMKRFGFTASFNRCAVSGNDTQADLIGYSFKFDGAISRQEASKDVHAVILSNKTLYLLDVLQKLPIDKMNSLNIHQEIIDEMSDIILMLYREYAGMFFKSQKLINQLKRLEQ

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]