From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004156000
  • symbol?:
  • description?: SigmaW regulon antibacterial protein

      descriptions from strain specific annotations:

    • SigmaW regulon antibacterial protein
    • protein YqfA
    • exported protein
  • strand?: -
  • coordinates?: 4421633..4422622
  • synteny block?: BlockID0031860
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1531
    08BA02176:
    C248_1616
    11819-97:
    MS7_1590
    71193:
    ST398NM01_1639
    ECT-R 2:
    ECTR2_1423
    ED133:
    SAOV_1573
    ED98:
    SAAV_1565
    HO 5096 0412:
    SAEMRSA15_14930
    JH1:
    SaurJH1_1665
    JH9:
    SaurJH9_1631
    JKD6008:
    SAA6008_01543
    JKD6159:
    SAA6159_01508
    LGA251:
    SARLGA251_14790
    M013:
    M013TW_1588
    MRSA252:
    SAR1650
    MSHR1132:
    SAMSHR1132_14130
    MSSA476:
    SAS1511
    Mu3:
    SAHV_1560
    Mu50:
    SAV1573
    MW2:
    MW1525
    RF122:
    SAB1445c
    ST398:
    SAPIG1639
    T0131:
    SAT0131_01669
    TCH60:
    HMPREF0772_11567
    TW20:
    SATW20_15690
    USA300_TCH1516:
    USA300HOU_1574
    VC40:
    SAVC_07115

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFSLSFIVIAVIIVVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP
    N315            MFSLSFIVIAVIIIVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP
    NCTC8325        MFSLSFIVIAVIIVVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP
    Newman          MFSLSFIVIAVIIVVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP
    USA300_FPR3757  MFSLSFIVIAVIIVVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP
                    *************:**********************************************

    COL             LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE
    N315            LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE
    NCTC8325        LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE
    Newman          LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE
    USA300_FPR3757  LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE
                    ************************************************************

    COL             AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS
    N315            AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS
    NCTC8325        AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS
    Newman          AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS
    USA300_FPR3757  AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS
                    ************************************************************

    COL             TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA
    N315            TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA
    NCTC8325        TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA
    Newman          TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA
    USA300_FPR3757  TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA
                    ************************************************************

    COL             DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY
    N315            DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY
    NCTC8325        DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY
    Newman          DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY
    USA300_FPR3757  DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY
                    ************************************************************

    COL             NLKNIEADTGMRNAINKRTDQSDDESPEH
    N315            NLKNIEADTGMRNAINKRTDQSDDESPEH
    NCTC8325        NLKNIEADTGMRNAINKRTDQSDDESPEH
    Newman          NLKNIEADTGMRNAINKRTDQSDDESPEH
    USA300_FPR3757  NLKNIEADTGMRNAINKRTDQSDDESPEH
                    *****************************