From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004163000
  • symbol?: dnaK
  • description?: molecular chaperone DnaK

      descriptions from strain specific annotations:

    • molecular chaperone DnaK
    • Chaperone protein DnaK
    • truncated molecular chaperone DnaK
    • DnaK protein
  • strand?: -
  • coordinates?: 4428463..4430296
  • synteny block?: BlockID0031930
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1637 (dnaK)
    N315:
    SA1409 (dnaK)
    NCTC8325:
    Newman:
    NWMN_1483 (dnaK)
    USA300_FPR3757:
    04-02981:
    SA2981_1538 (dnaK)
    08BA02176:
    C248_1623 (dnaK)
    11819-97:
    MS7_1597 (dnaK)
    71193:
    ST398NM01_1646
    ECT-R 2:
    ECTR2_1430 (dnaK)
    ED133:
    SAOV_1580 (dnaK)
    ED98:
    SAAV_1572 (dnaK)
    HO 5096 0412:
    SAEMRSA15_15000 (dnaK)
    JH1:
    SaurJH1_1672 (dnaK)
    JH9:
    SaurJH9_1638 (dnaK)
    JKD6008:
    SAA6008_01550 (dnaK)
    JKD6159:
    SAA6159_01515 (dnaK)
    LGA251:
    SARLGA251_14860 (dnaK)
    M013:
    M013TW_1595
    MRSA252:
    SAR1657 (dnaK)
    MSHR1132:
    SAMSHR1132_14200
    MSSA476:
    SAS1518 (dnaK)
    Mu3:
    SAHV_1567 (dnaK)
    Mu50:
    SAV1580 (dnaK)
    MW2:
    MW1532 (dnaK)
    RF122:
    SAB1452c (dnaK)
    ST398:
    SAPIG1646 (dnaK)
    T0131:
    SAT0131_01676
    TCH60:
    HMPREF0772_11560 (dnaK)
    TW20:
    SATW20_15760 (dnaK)
    USA300_TCH1516:
    USA300HOU_1581 (dnaK)
    VC40:
    SAVC_07146 (dnaK)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKIIGIDLGTTNSCVTVLEGDEPKVIQNPEGSRTTPSVVAFKNGETQVGEVAKRQAITN
    N315            MSKIIGIDLGTTNSCVTVLEGDEPKVIQNPEGSRTTPSVVAFKNGETQVGEVAKRQAITN
    NCTC8325        MSKIIGIDLGTTNSCVTVLEGDEPKVIQNPEGSRTTPSVVAFKNGETQVGEVAKRQAITN
    Newman          MSKIIGIDLGTTNSCVTVLEGDEPKVIQNPEGSRTTPSVVAFKNGETQVGEVAKRQAITN
    USA300_FPR3757  MSKIIGIDLGTTNSCVTVLEGDEPKVIQNPEGSRTTPSVVAFKNGETQVGEVAKRQAITN
                    ************************************************************

    COL             PNTVQSIKRHMGTDYKVDIEGKSYTPQEISAMILQNLKNTAESYLGEKVDKAVITVPAYF
    N315            PNTVQSIKRHMGTDYKVDIEGKSYTPQEISAMILQNLKNTAESYLGEKVDKAVITVPAYF
    NCTC8325        PNTVQSIKRHMGTDYKVDIEGKSYTPQEISAMILQNLKNTAESYLGEKVDKAVITVPAYF
    Newman          PNTVQSIKRHMGTDYKVDIEGKSYTPQEISAMILQNLKNTAESYLGEKVDKAVITVPAYF
    USA300_FPR3757  PNTVQSIKRHMGTDYKVDIEGKSYTPQEISAMILQNLKNTAESYLGEKVDKAVITVPAYF
                    ************************************************************

    COL             NDAERQATKDAGKIAGLEVERIINEPTAAALAYGLDKTDKDEKVLVFDLGGGTFDVSILE
    N315            NDAERQATKDAGKIAGLEVERIINEPTAAALAYGLDKTDKDEKVLVFDLGGGTFDVSILE
    NCTC8325        NDAERQATKDAGKIAGLEVERIINEPTAAALAYGLDKTDKDEKVLVFDLGGGTFDVSILE
    Newman          NDAERQATKDAGKIAGLEVERIINEPTAAALAYGLDKTDKDEKVLVFDLGGGTFDVSILE
    USA300_FPR3757  NDAERQATKDAGKIAGLEVERIINEPTAAALAYGLDKTDKDEKVLVFDLGGGTFDVSILE
                    ************************************************************

    COL             LGDGVFEVLSTAGDNKLGGDDFDQVIIDYLVAEFKKENGVDLSQDKMALQRLKDAAEKAK
    N315            LGDGVFEVLSTAGDNKLGGDDFDQVIIDYLVAEFKKENGVDLSQDKMALQRLKDAAEKAK
    NCTC8325        LGDGVFEVLSTAGDNKLGGDDFDQVIIDYLVAEFKKENGVDLSQDKMALQRLKDAAEKAK
    Newman          LGDGVFEVLSTAGDNKLGGDDFDQVIIDYLVAEFKKENGVDLSQDKMALQRLKDAAEKAK
    USA300_FPR3757  LGDGVFEVLSTAGDNKLGGDDFDQVIIDYLVAEFKKENGVDLSQDKMALQRLKDAAEKAK
                    ************************************************************

    COL             KDLSGVSQTQISLPFISAGENGPLHLEVNLTRSKFEELSDSLIRRTMEPTRQAMKDAGLT
    N315            KDLSGVSQTQISLPFISAGENGPLHLEVNLTRSKFEELSDSLIRRTMEPTRQAMKDAGLT
    NCTC8325        KDLSGVSQTQISLPFISAGENGPLHLEVNLTRSKFEELSDSLIRRTMEPTRQAMKDAGLT
    Newman          KDLSGVSQTQISLPFISAGENGPLHLEVNLTRSKFEELSDSLIRRTMEPTRQAMKDAGLT
    USA300_FPR3757  KDLSGVSQTQISLPFISAGENGPLHLEVNLTRSKFEELSDSLIRRTMEPTRQAMKDAGLT
                    ************************************************************

    COL             NSDIDEVILVGGSTRIPAVQEAVKKEIGKEPNKGVNPDEVVAMGAAIQGGVITGDVKDVV
    N315            NSDIDEVILVGGSTRIPAVQEAVKKEIGKEPNKGVNPDEVVAMGAAIQGGVITGDVKDVV
    NCTC8325        NSDIDEVILVGGSTRIPAVQEAVKKEIGKEPNKGVNPDEVVAMGAAIQGGVITGDVKDVV
    Newman          NSDIDEVILVGGSTRIPAVQEAVKKEIGKEPNKGVNPDEVVAMGAAIQGGVITGDVKDVV
    USA300_FPR3757  NSDIDEVILVGGSTRIPAVQEAVKKEIGKEPNKGVNPDEVVAMGAAIQGGVITGDVKDVV
                    ************************************************************

    COL             LLDVTPLSLGIEILGGRMNTLIERNTTIPTSKSQIYSTAVDNQPSVDVHVLQGERPMAAD
    N315            LLDVTPLSLGIEILGGRMNTLIERNTTIPTSKSQIYSTAVDNQPSVDVHVLQGERPMAAD
    NCTC8325        LLDVTPLSLGIEILGGRMNTLIERNTTIPTSKSQIYSTAVDNQPSVDVHVLQGERPMAAD
    Newman          LLDVTPLSLGIEILGGRMNTLIERNTTIPTSKSQIYSTAVDNQPSVDVHVLQGERPMAAD
    USA300_FPR3757  LLDVTPLSLGIEILGGRMNTLIERNTTIPTSKSQIYSTAVDNQPSVDVHVLQGERPMAAD
                    ************************************************************

    COL             NKTLGRFQLTDIPPAERGKPQIEVTFDIDKNGIVNVTAKDLGTNKEQRITIQSSSSLSDE
    N315            NKTLGRFQLTDIPPAERGKPQIEVTFDIDKNGIVNVTAKDLGTNKEQRITIQSSSSLSDE
    NCTC8325        NKTLGRFQLTDIPPAERGKPQIEVTFDIDKNGIVNVTAKDLGTNKEQRITIQSSSSLSDE
    Newman          NKTLGRFQLTDIPPAERGKPQIEVTFDIDKNGIVNVTAKDLGTNKEQRITIQSSSSLSDE
    USA300_FPR3757  NKTLGRFQLTDIPPAERGKPQIEVTFDIDKNGIVNVTAKDLGTNKEQRITIQSSSSLSDE
                    ************************************************************

    COL             EIDRMVKDAEVNAEADKKRREEVDLRNEADSLVFQVEKTLTDLGENIGEEDKKSAEEKKD
    N315            EIDRMVKDAEVNAEADKKRREEVDLRNEADSLVFQVEKTLTDLGENIGEEDKKSAEEKKD
    NCTC8325        EIDRMVKDAEVNAEADKKRREEVDLRNEADSLVFQVEKTLTDLGENIGEEDKKSAEEKKD
    Newman          EIDRMVKDAEVNAEADKKRREEVDLRNEADSLVFQVEKTLTDLGENIGEEDKKSAEEKKD
    USA300_FPR3757  EIDRMVKDAEVNAEADKKRREEVDLRNEADSLVFQVEKTLTDLGENIGEEDKKSAEEKKD
                    ************************************************************

    COL             ALKTALEGQDIEDIKSKKEELEKVIQELSAKVYEQAAQQQQQAQGANAGQNNDSTVEDAE
    N315            ALKTALEGQDIEDIKSKKEELEKVIQELSAKVYEQAAQQQQQAQGANAGQNNDSTVEDAE
    NCTC8325        ALKTALEGQDIEDIKSKKEELEKVIQELSAKVYEQAAQQQQQAQGANAGQNNDSTVEDAE
    Newman          ALKTALEGQDIEDIKSKKEELEKVIQELSAKVYEQAAQQQQQAQGANAGQNNDSTVEDAE
    USA300_FPR3757  ALKTALEGQDIEDIKSKKEELEKVIQELSAKVYEQAAQQQQQAQGANAGQNNDSTVEDAE
                    ************************************************************

    COL             FKEVKDDDKK
    N315            FKEVKDDDKK
    NCTC8325        FKEVKDDDKK
    Newman          FKEVKDDDKK
    USA300_FPR3757  FKEVKDDDKK
                    **********